BLASTX nr result
ID: Salvia21_contig00000626
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00000626 (527 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P05993.1|PAPA5_CARPA RecName: Full=Cysteine proteinase; AltNa... 55 5e-06 >sp|P05993.1|PAPA5_CARPA RecName: Full=Cysteine proteinase; AltName: Full=Clone PLBPC13 gi|18086|emb|CAA27609.1| pot. cysteine proteinase [Carica papaya] Length = 96 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -2 Query: 526 EDGYYKICRGYNLCGVESMVSTVTAVHLNSQ 434 E+GYYKICRG N+CGV+SMVSTV AVH SQ Sbjct: 66 ENGYYKICRGRNICGVDSMVSTVAAVHTTSQ 96