BLASTX nr result
ID: Salvia21_contig00000351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00000351 (927 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003605622.1| hypothetical protein MTR_4g035030 [Medicago ... 40 3e-06 ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago ... 39 7e-06 >ref|XP_003605622.1| hypothetical protein MTR_4g035030 [Medicago truncatula] gi|357471517|ref|XP_003606043.1| hypothetical protein MTR_4g051230 [Medicago truncatula] gi|358349395|ref|XP_003638723.1| hypothetical protein MTR_141s0027 [Medicago truncatula] gi|355504658|gb|AES85861.1| hypothetical protein MTR_141s0027 [Medicago truncatula] gi|355506677|gb|AES87819.1| hypothetical protein MTR_4g035030 [Medicago truncatula] gi|355507098|gb|AES88240.1| hypothetical protein MTR_4g051230 [Medicago truncatula] Length = 95 Score = 39.7 bits (91), Expect(2) = 3e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +3 Query: 171 MAKSVDATDLIGLSLGMETY 230 MAK VDATDLIGLSLGMETY Sbjct: 1 MAKLVDATDLIGLSLGMETY 20 Score = 38.5 bits (88), Expect(2) = 3e-06 Identities = 22/33 (66%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = +1 Query: 238 TFKFRETP*LIKTGNPEPNPIFSKQ-NKHLKKD 333 TFKFRET L K GNPEPNP F KQ NK L+ + Sbjct: 24 TFKFRETLEL-KMGNPEPNPSFRKQINKSLESE 55 >ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago truncatula] gi|355516767|gb|AES98390.1| hypothetical protein MTR_5g067940 [Medicago truncatula] Length = 69 Score = 38.5 bits (88), Expect(2) = 7e-06 Identities = 22/33 (66%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = +1 Query: 238 TFKFRETP*LIKTGNPEPNPIFSKQ-NKHLKKD 333 TFKFRET L K GNPEPNP F KQ NK L+ + Sbjct: 24 TFKFRETLEL-KMGNPEPNPSFRKQINKSLESE 55 Score = 38.1 bits (87), Expect(2) = 7e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = +3 Query: 171 MAKSVDATDLIGLSLGMETY 230 MA+ VDATDLIGLSLGMETY Sbjct: 1 MAELVDATDLIGLSLGMETY 20