BLASTX nr result
ID: Rheum21_contig00039326
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00039326 (421 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007516863.1| hypothetical protein GlmaxMp14 (mitochondrio... 57 3e-06 >ref|YP_007516863.1| hypothetical protein GlmaxMp14 (mitochondrion) [Glycine max] gi|403311592|gb|AFR34340.1| hypothetical protein GlmaxMp14 (mitochondrion) [Glycine max] Length = 202 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +3 Query: 297 NPIQTRGFSPTYTRCWSRSRLVVPFSMIVDSTFLSC 404 NPIQ P YTRCWSRSRL VP SMIVDST +SC Sbjct: 15 NPIQGAFPQPIYTRCWSRSRLAVPLSMIVDSTLISC 50