BLASTX nr result
ID: Rheum21_contig00038541
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00038541 (275 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002311637.2| hypothetical protein POPTR_0008s15660g [Popu... 56 4e-06 >ref|XP_002311637.2| hypothetical protein POPTR_0008s15660g [Populus trichocarpa] gi|550333157|gb|EEE89004.2| hypothetical protein POPTR_0008s15660g [Populus trichocarpa] Length = 304 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/55 (45%), Positives = 36/55 (65%) Frame = +3 Query: 3 NSTSLPCYPECALGGDCPKLGIPLFNQSTAPSPTLNNAGDTTNLARSLQHEKLSW 167 N ++ PCY +CA+G DC LGI + N+S AP+P + AG++ N A S+ EK W Sbjct: 240 NVSTFPCYKDCAIGMDCSNLGIMMSNKSAAPTPVM--AGNSMNQASSILQEKFLW 292