BLASTX nr result
ID: Rheum21_contig00038518
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00038518 (687 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB65597.1| Fruit protein [Morus notabilis] 62 2e-07 >gb|EXB65597.1| Fruit protein [Morus notabilis] Length = 281 Score = 62.0 bits (149), Expect = 2e-07 Identities = 46/129 (35%), Positives = 68/129 (52%), Gaps = 8/129 (6%) Frame = -1 Query: 687 PDLVASYMRAGQHVRKRASDSTSSCVSRILP------GRRSLLWLLRLQTRPHRRG*ICS 526 PDL AS+ RAGQ+++ + DS I G+ +L++ S Sbjct: 87 PDLAASHNRAGQYLQLKVPDSEKPSFLAIASPPSLAAGKGVFEFLVKSVAGS-------S 139 Query: 525 KIVLTGLRMEEGDLLELSPILGHEFDVDRISHAEEFPFVLFFATKY*IRIYEATVQS--N 352 +L GL+ GD++EL P++G+ FDVDRI EEFP VL FAT I + ++S + Sbjct: 140 AEILCGLK--RGDVVELGPVMGNGFDVDRIQPPEEFPTVLIFATGSGISPIRSLIESGFS 197 Query: 351 ASKFSQIRI 325 ASK S +R+ Sbjct: 198 ASKRSDVRL 206