BLASTX nr result
ID: Rheum21_contig00036820
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00036820 (226 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFP93559.1| cellulose synthase A1 [Neolamarckia cadamba] 94 1e-17 gb|AFJ12112.1| cellulose synthase, partial [Nicotiana tabacum] 93 3e-17 ref|XP_002276890.2| PREDICTED: cellulose synthase A catalytic su... 93 3e-17 ref|XP_002276866.1| PREDICTED: cellulose synthase A catalytic su... 93 3e-17 dbj|BAG06271.1| cellulose synthase Z811 [Zinnia elegans] 93 3e-17 emb|CAN73700.1| hypothetical protein VITISV_013112 [Vitis vinifera] 93 3e-17 gb|EXB42931.1| OsCesA7 protein [Morus notabilis] 92 7e-17 gb|AHH81946.1| cellulose synthase [Boehmeria nivea] 92 7e-17 ref|XP_006343620.1| PREDICTED: cellulose synthase A catalytic su... 92 7e-17 gb|EMJ05869.1| hypothetical protein PRUPE_ppa000618mg [Prunus pe... 92 7e-17 ref|XP_004242614.1| PREDICTED: cellulose synthase A catalytic su... 92 7e-17 ref|XP_006381880.1| hypothetical protein POPTR_0006s19580g [Popu... 91 1e-16 gb|AFZ78559.1| cellulose synthase [Populus tomentosa] 91 1e-16 gb|AFR39205.1| cellulose synthase, partial [Populus fremontii] 91 1e-16 gb|AFR39202.1| cellulose synthase, partial [Populus fremontii] 91 1e-16 gb|AFR39195.1| cellulose synthase, partial [Populus alba] 91 1e-16 gb|AFR39190.1| cellulose synthase, partial [Populus trichocarpa]... 91 1e-16 gb|AFR39185.1| cellulose synthase, partial [Populus trichocarpa]... 91 1e-16 gb|AFR39184.1| cellulose synthase, partial [Populus trichocarpa] 91 1e-16 gb|AEE60896.1| cellulose synthase [Populus tomentosa] 91 1e-16 >gb|AFP93559.1| cellulose synthase A1 [Neolamarckia cadamba] Length = 1041 Score = 94.4 bits (233), Expect = 1e-17 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -3 Query: 224 NRTPTIVIVWSILLASIFSLLWVRIDPFVLKTKGPDVKQCGINC 93 NRTPTIVI+WSILLASIFSLLWVRIDPFVLKTKGPDVKQCGINC Sbjct: 998 NRTPTIVIIWSILLASIFSLLWVRIDPFVLKTKGPDVKQCGINC 1041 >gb|AFJ12112.1| cellulose synthase, partial [Nicotiana tabacum] Length = 410 Score = 93.2 bits (230), Expect = 3e-17 Identities = 41/44 (93%), Positives = 44/44 (100%) Frame = -3 Query: 224 NRTPTIVIVWSILLASIFSLLWVRIDPFVLKTKGPDVKQCGINC 93 NRTPTIV++WSILLASIFSLLWVRIDPFVLKTKGPDVKQCG+NC Sbjct: 367 NRTPTIVVIWSILLASIFSLLWVRIDPFVLKTKGPDVKQCGLNC 410 >ref|XP_002276890.2| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like isoform 2 [Vitis vinifera] gi|297743668|emb|CBI36551.3| unnamed protein product [Vitis vinifera] Length = 1037 Score = 93.2 bits (230), Expect = 3e-17 Identities = 40/44 (90%), Positives = 44/44 (100%) Frame = -3 Query: 224 NRTPTIVIVWSILLASIFSLLWVRIDPFVLKTKGPDVKQCGINC 93 NRTPTIV++WS+LLASIFSLLWVRIDPF+LKTKGPDVKQCGINC Sbjct: 994 NRTPTIVVIWSVLLASIFSLLWVRIDPFILKTKGPDVKQCGINC 1037 >ref|XP_002276866.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like isoform 1 [Vitis vinifera] Length = 1025 Score = 93.2 bits (230), Expect = 3e-17 Identities = 40/44 (90%), Positives = 44/44 (100%) Frame = -3 Query: 224 NRTPTIVIVWSILLASIFSLLWVRIDPFVLKTKGPDVKQCGINC 93 NRTPTIV++WS+LLASIFSLLWVRIDPF+LKTKGPDVKQCGINC Sbjct: 982 NRTPTIVVIWSVLLASIFSLLWVRIDPFILKTKGPDVKQCGINC 1025 >dbj|BAG06271.1| cellulose synthase Z811 [Zinnia elegans] Length = 206 Score = 93.2 bits (230), Expect = 3e-17 Identities = 41/44 (93%), Positives = 44/44 (100%) Frame = -3 Query: 224 NRTPTIVIVWSILLASIFSLLWVRIDPFVLKTKGPDVKQCGINC 93 NRTPTIV++WSILLASIFSLLWVRIDPFVLKTKGPDVKQCG+NC Sbjct: 163 NRTPTIVVIWSILLASIFSLLWVRIDPFVLKTKGPDVKQCGLNC 206 >emb|CAN73700.1| hypothetical protein VITISV_013112 [Vitis vinifera] Length = 1024 Score = 93.2 bits (230), Expect = 3e-17 Identities = 40/44 (90%), Positives = 44/44 (100%) Frame = -3 Query: 224 NRTPTIVIVWSILLASIFSLLWVRIDPFVLKTKGPDVKQCGINC 93 NRTPTIV++WS+LLASIFSLLWVRIDPF+LKTKGPDVKQCGINC Sbjct: 981 NRTPTIVVIWSVLLASIFSLLWVRIDPFILKTKGPDVKQCGINC 1024 >gb|EXB42931.1| OsCesA7 protein [Morus notabilis] Length = 1042 Score = 92.0 bits (227), Expect = 7e-17 Identities = 39/44 (88%), Positives = 44/44 (100%) Frame = -3 Query: 224 NRTPTIVIVWSILLASIFSLLWVRIDPFVLKTKGPDVKQCGINC 93 NRTPTIV++WS+LLASIFSLLWVRIDPFV+KTKGPDVKQCG+NC Sbjct: 999 NRTPTIVVIWSVLLASIFSLLWVRIDPFVMKTKGPDVKQCGLNC 1042 >gb|AHH81946.1| cellulose synthase [Boehmeria nivea] Length = 1039 Score = 92.0 bits (227), Expect = 7e-17 Identities = 39/44 (88%), Positives = 44/44 (100%) Frame = -3 Query: 224 NRTPTIVIVWSILLASIFSLLWVRIDPFVLKTKGPDVKQCGINC 93 NRTPTIV++WS+LLASIFSLLWVRIDPFV+KTKGPDVKQCG+NC Sbjct: 996 NRTPTIVVIWSVLLASIFSLLWVRIDPFVMKTKGPDVKQCGLNC 1039 >ref|XP_006343620.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like [Solanum tuberosum] Length = 1041 Score = 92.0 bits (227), Expect = 7e-17 Identities = 40/44 (90%), Positives = 44/44 (100%) Frame = -3 Query: 224 NRTPTIVIVWSILLASIFSLLWVRIDPFVLKTKGPDVKQCGINC 93 NRTPTIV++WSILLASIFSLLWVRIDPFVLKTKGPDVK+CG+NC Sbjct: 998 NRTPTIVVIWSILLASIFSLLWVRIDPFVLKTKGPDVKRCGVNC 1041 >gb|EMJ05869.1| hypothetical protein PRUPE_ppa000618mg [Prunus persica] Length = 1069 Score = 92.0 bits (227), Expect = 7e-17 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -3 Query: 224 NRTPTIVIVWSILLASIFSLLWVRIDPFVLKTKGPDVKQCGINC 93 NRTPTIV++WS+LLASIFSLLWVRIDPFVLKTKGPD KQCGINC Sbjct: 1026 NRTPTIVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKQCGINC 1069 >ref|XP_004242614.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like [Solanum lycopersicum] Length = 1041 Score = 92.0 bits (227), Expect = 7e-17 Identities = 40/44 (90%), Positives = 44/44 (100%) Frame = -3 Query: 224 NRTPTIVIVWSILLASIFSLLWVRIDPFVLKTKGPDVKQCGINC 93 NRTPTIV++WSILLASIFSLLWVRIDPFVLKTKGPDVK+CG+NC Sbjct: 998 NRTPTIVVIWSILLASIFSLLWVRIDPFVLKTKGPDVKRCGVNC 1041 >ref|XP_006381880.1| hypothetical protein POPTR_0006s19580g [Populus trichocarpa] gi|550336663|gb|ERP59677.1| hypothetical protein POPTR_0006s19580g [Populus trichocarpa] Length = 1036 Score = 91.3 bits (225), Expect = 1e-16 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -3 Query: 224 NRTPTIVIVWSILLASIFSLLWVRIDPFVLKTKGPDVKQCGINC 93 NRTPTIV++WS+LLASIFSLLWVRIDPFV+KTKGPD KQCGINC Sbjct: 993 NRTPTIVVIWSVLLASIFSLLWVRIDPFVMKTKGPDTKQCGINC 1036 >gb|AFZ78559.1| cellulose synthase [Populus tomentosa] Length = 1036 Score = 91.3 bits (225), Expect = 1e-16 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -3 Query: 224 NRTPTIVIVWSILLASIFSLLWVRIDPFVLKTKGPDVKQCGINC 93 NRTPTIV++WS+LLASIFSLLWVRIDPFV+KTKGPD KQCGINC Sbjct: 993 NRTPTIVVIWSVLLASIFSLLWVRIDPFVMKTKGPDTKQCGINC 1036 >gb|AFR39205.1| cellulose synthase, partial [Populus fremontii] Length = 72 Score = 91.3 bits (225), Expect = 1e-16 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -3 Query: 224 NRTPTIVIVWSILLASIFSLLWVRIDPFVLKTKGPDVKQCGINC 93 NRTPTIV++WS+LLASIFSLLWVRIDPFV+KTKGPD KQCGINC Sbjct: 29 NRTPTIVVIWSVLLASIFSLLWVRIDPFVMKTKGPDTKQCGINC 72 >gb|AFR39202.1| cellulose synthase, partial [Populus fremontii] Length = 72 Score = 91.3 bits (225), Expect = 1e-16 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -3 Query: 224 NRTPTIVIVWSILLASIFSLLWVRIDPFVLKTKGPDVKQCGINC 93 NRTPTIV++WS+LLASIFSLLWVRIDPFV+KTKGPD KQCGINC Sbjct: 29 NRTPTIVVIWSVLLASIFSLLWVRIDPFVMKTKGPDTKQCGINC 72 >gb|AFR39195.1| cellulose synthase, partial [Populus alba] Length = 70 Score = 91.3 bits (225), Expect = 1e-16 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -3 Query: 224 NRTPTIVIVWSILLASIFSLLWVRIDPFVLKTKGPDVKQCGINC 93 NRTPTIV++WS+LLASIFSLLWVRIDPFV+KTKGPD KQCGINC Sbjct: 27 NRTPTIVVIWSVLLASIFSLLWVRIDPFVMKTKGPDTKQCGINC 70 >gb|AFR39190.1| cellulose synthase, partial [Populus trichocarpa] gi|403323136|gb|AFR39191.1| cellulose synthase, partial [Populus trichocarpa] Length = 47 Score = 91.3 bits (225), Expect = 1e-16 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -3 Query: 224 NRTPTIVIVWSILLASIFSLLWVRIDPFVLKTKGPDVKQCGINC 93 NRTPTIV++WS+LLASIFSLLWVRIDPFV+KTKGPD KQCGINC Sbjct: 4 NRTPTIVVIWSVLLASIFSLLWVRIDPFVMKTKGPDTKQCGINC 47 >gb|AFR39185.1| cellulose synthase, partial [Populus trichocarpa] gi|403323126|gb|AFR39186.1| cellulose synthase, partial [Populus trichocarpa] gi|403323128|gb|AFR39187.1| cellulose synthase, partial [Populus trichocarpa] gi|403323130|gb|AFR39188.1| cellulose synthase, partial [Populus trichocarpa] gi|403323132|gb|AFR39189.1| cellulose synthase, partial [Populus trichocarpa] gi|403323138|gb|AFR39192.1| cellulose synthase, partial [Populus trichocarpa] gi|403323140|gb|AFR39193.1| cellulose synthase, partial [Populus trichocarpa] gi|403323142|gb|AFR39194.1| cellulose synthase, partial [Populus trichocarpa] gi|403323146|gb|AFR39196.1| cellulose synthase, partial [Populus alba] gi|403323148|gb|AFR39197.1| cellulose synthase, partial [Populus alba] gi|403323150|gb|AFR39198.1| cellulose synthase, partial [Populus alba] gi|403323152|gb|AFR39199.1| cellulose synthase, partial [Populus alba] gi|403323154|gb|AFR39200.1| cellulose synthase, partial [Populus fremontii] gi|403323156|gb|AFR39201.1| cellulose synthase, partial [Populus fremontii] gi|403323160|gb|AFR39203.1| cellulose synthase, partial [Populus fremontii] gi|403323162|gb|AFR39204.1| cellulose synthase, partial [Populus fremontii] gi|403323166|gb|AFR39206.1| cellulose synthase, partial [Populus fremontii] gi|403323168|gb|AFR39207.1| cellulose synthase, partial [Populus fremontii] gi|403323170|gb|AFR39208.1| cellulose synthase, partial [Populus fremontii] gi|403323172|gb|AFR39209.1| cellulose synthase, partial [Populus fremontii] gi|403323174|gb|AFR39210.1| cellulose synthase, partial [Populus fremontii] gi|403323176|gb|AFR39211.1| cellulose synthase, partial [Populus fremontii] gi|403323178|gb|AFR39212.1| cellulose synthase, partial [Populus nigra] gi|403323182|gb|AFR39214.1| cellulose synthase, partial [Populus nigra] gi|403323184|gb|AFR39215.1| cellulose synthase, partial [Populus nigra] gi|403323186|gb|AFR39216.1| cellulose synthase, partial [Populus nigra] gi|403323188|gb|AFR39217.1| cellulose synthase, partial [Populus nigra] gi|403323190|gb|AFR39218.1| cellulose synthase, partial [Populus nigra] gi|403323192|gb|AFR39219.1| cellulose synthase, partial [Populus nigra] gi|403323194|gb|AFR39220.1| cellulose synthase, partial [Populus nigra] gi|403323196|gb|AFR39221.1| cellulose synthase, partial [Populus nigra] gi|403323198|gb|AFR39222.1| cellulose synthase, partial [Populus nigra] gi|403323200|gb|AFR39223.1| cellulose synthase, partial [Populus nigra] gi|403323202|gb|AFR39224.1| cellulose synthase, partial [Populus nigra] gi|403323204|gb|AFR39225.1| cellulose synthase, partial [Populus nigra] Length = 72 Score = 91.3 bits (225), Expect = 1e-16 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -3 Query: 224 NRTPTIVIVWSILLASIFSLLWVRIDPFVLKTKGPDVKQCGINC 93 NRTPTIV++WS+LLASIFSLLWVRIDPFV+KTKGPD KQCGINC Sbjct: 29 NRTPTIVVIWSVLLASIFSLLWVRIDPFVMKTKGPDTKQCGINC 72 >gb|AFR39184.1| cellulose synthase, partial [Populus trichocarpa] Length = 72 Score = 91.3 bits (225), Expect = 1e-16 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -3 Query: 224 NRTPTIVIVWSILLASIFSLLWVRIDPFVLKTKGPDVKQCGINC 93 NRTPTIV++WS+LLASIFSLLWVRIDPFV+KTKGPD KQCGINC Sbjct: 29 NRTPTIVVIWSVLLASIFSLLWVRIDPFVMKTKGPDTKQCGINC 72 >gb|AEE60896.1| cellulose synthase [Populus tomentosa] Length = 1036 Score = 91.3 bits (225), Expect = 1e-16 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -3 Query: 224 NRTPTIVIVWSILLASIFSLLWVRIDPFVLKTKGPDVKQCGINC 93 NRTPTIV++WS+LLASIFSLLWVRIDPFV+KTKGPD KQCGINC Sbjct: 993 NRTPTIVVIWSVLLASIFSLLWVRIDPFVMKTKGPDTKQCGINC 1036