BLASTX nr result
ID: Rheum21_contig00036759
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00036759 (561 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN79390.1| hypothetical protein VITISV_004910 [Vitis vinifera] 60 5e-07 >emb|CAN79390.1| hypothetical protein VITISV_004910 [Vitis vinifera] Length = 418 Score = 59.7 bits (143), Expect = 5e-07 Identities = 35/46 (76%), Positives = 38/46 (82%), Gaps = 2/46 (4%) Frame = -2 Query: 134 QSGN-KKEVHDYNGVIEETASKLMEKR-NKVRALAGAFETVISLQD 3 QS N KK+ YN VIEETASKL+EKR NKVRAL GAFETVISLQ+ Sbjct: 368 QSANGKKDSQVYNEVIEETASKLLEKRKNKVRALVGAFETVISLQE 413