BLASTX nr result
ID: Rheum21_contig00036719
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00036719 (365 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA65994.1| hypothetical protein [Beta vulgaris subsp. vulga... 73 4e-16 >emb|CCA65994.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 803 Score = 73.2 bits (178), Expect(2) = 4e-16 Identities = 30/72 (41%), Positives = 51/72 (70%) Frame = +1 Query: 148 RPYYVFGKLMLLNPWCSNFDPFSESISTIDMWIRIPQLLVEYISFYAISTILEMNNLGTL 327 RP+++ G L++L PW +FDP+ E I +D+W+RIP+L E ++F +I+ +L N++G L Sbjct: 401 RPWHIQGDLLVLQPWKPSFDPYLEEIKWVDLWVRIPRLPTELLNFDSIANLLASNDIGAL 460 Query: 328 IKLDPFTVKKTK 363 IKLD ++ + K Sbjct: 461 IKLDQRSLLRNK 472 Score = 37.0 bits (84), Expect(2) = 4e-16 Identities = 16/33 (48%), Positives = 21/33 (63%) Frame = +2 Query: 14 IRTKLKNDWRFVEGSFEILEKPNLWFEMRFANP 112 I ++ K DWR V+G + LE N W +RFANP Sbjct: 359 IISRTKADWRVVKGDVDYLEMGNGWILLRFANP 391