BLASTX nr result
ID: Rheum21_contig00036615
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00036615 (622 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004298859.1| PREDICTED: BTB/POZ domain-containing protein... 57 3e-06 ref|XP_006396293.1| hypothetical protein EUTSA_v10028626mg [Eutr... 57 5e-06 gb|ADN34171.1| ATPOB protein binding [Cucumis melo subsp. melo] 56 7e-06 ref|XP_006397813.1| hypothetical protein EUTSA_v10001385mg [Eutr... 56 9e-06 ref|XP_006397812.1| hypothetical protein EUTSA_v10001385mg [Eutr... 56 9e-06 gb|EOX95810.1| POZ/BTB containin G-protein 1 isoform 6 [Theobrom... 56 9e-06 gb|EOX95809.1| POZ/BTB containin G-protein 1 isoform 5 [Theobrom... 56 9e-06 gb|EOX95808.1| POZ/BTB containin G-protein 1 isoform 4 [Theobrom... 56 9e-06 gb|EOX95807.1| POZ/BTB containin G-protein 1 isoform 3 [Theobrom... 56 9e-06 gb|EOX95806.1| POZ/BTB containin G-protein 1 isoform 2 [Theobrom... 56 9e-06 gb|EOX95805.1| POZ/BTB containin G-protein 1 isoform 1 [Theobrom... 56 9e-06 emb|CBI40464.3| unnamed protein product [Vitis vinifera] 56 9e-06 ref|XP_002279915.1| PREDICTED: BTB/POZ domain-containing protein... 56 9e-06 >ref|XP_004298859.1| PREDICTED: BTB/POZ domain-containing protein At2g46260-like [Fragaria vesca subsp. vesca] Length = 543 Score = 57.4 bits (137), Expect = 3e-06 Identities = 41/102 (40%), Positives = 58/102 (56%), Gaps = 6/102 (5%) Frame = -3 Query: 509 GR*FSLLAQYQEKKENSADHLGLFVEMT--GSKSCTLRFEFTVMKRPSKEFQTQGTAIKC 336 G+ F L A ++NS LGLF+ M GS S + +EF+V +P +EFQ++ K Sbjct: 441 GQGFFLSAHCNMDQQNSFQCLGLFLGMQEKGSVSFVVDYEFSVRVKPEEEFQSKH---KG 497 Query: 335 TLTATE-KAEGE---WPFEWTDLMRDNSVYFIDEILHLRAQL 222 T T T KA G WT M D+S+YFI+ +LHL+A+L Sbjct: 498 TYTFTGGKAVGYRNLLAIPWTTFMADDSIYFINSVLHLQAEL 539 >ref|XP_006396293.1| hypothetical protein EUTSA_v10028626mg [Eutrema salsugineum] gi|557097310|gb|ESQ37746.1| hypothetical protein EUTSA_v10028626mg [Eutrema salsugineum] Length = 476 Score = 56.6 bits (135), Expect = 5e-06 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 6/106 (5%) Frame = -3 Query: 509 GR*FSLLAQYQEKKENSADHLGLFVEMTGSKSCTLRFEFTVMKRPSKEFQTQGTAIKCTL 330 G+ F L A + N + GL++ M GS S T+ +EF+ +P+++F A+KC Sbjct: 374 GQEFHLSADCNMDQLNLSHRFGLYIWMHGSMSLTVDYEFSARSKPTEDF-----AVKCRG 428 Query: 329 TAT---EKAEG---EWPFEWTDLMRDNSVYFIDEILHLRAQLSTKN 210 T KA G + W + ++S YFI+++LHLRA+LS +N Sbjct: 429 KYTFTGGKAIGFRDMFATPWDSFIAEDSPYFINDVLHLRAELSIRN 474 >gb|ADN34171.1| ATPOB protein binding [Cucumis melo subsp. melo] Length = 552 Score = 56.2 bits (134), Expect = 7e-06 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -2 Query: 621 SQQEAAMALPLCAIEVVLGSDDLQLCSEDVVLDFILKWA 505 ++QE MALPL +E +L SDDLQ+ SED V DFILKWA Sbjct: 281 TKQEEVMALPLAGVEAILSSDDLQVASEDAVYDFILKWA 319 >ref|XP_006397813.1| hypothetical protein EUTSA_v10001385mg [Eutrema salsugineum] gi|557098886|gb|ESQ39266.1| hypothetical protein EUTSA_v10001385mg [Eutrema salsugineum] Length = 554 Score = 55.8 bits (133), Expect = 9e-06 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = -2 Query: 615 QEAAMALPLCAIEVVLGSDDLQLCSEDVVLDFILKWA 505 QE MALPL IE +L SDDLQ+ SED V DF+LKWA Sbjct: 283 QEEVMALPLAGIEAILSSDDLQIASEDAVYDFVLKWA 319 >ref|XP_006397812.1| hypothetical protein EUTSA_v10001385mg [Eutrema salsugineum] gi|557098885|gb|ESQ39265.1| hypothetical protein EUTSA_v10001385mg [Eutrema salsugineum] Length = 530 Score = 55.8 bits (133), Expect = 9e-06 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = -2 Query: 615 QEAAMALPLCAIEVVLGSDDLQLCSEDVVLDFILKWA 505 QE MALPL IE +L SDDLQ+ SED V DF+LKWA Sbjct: 259 QEEVMALPLAGIEAILSSDDLQIASEDAVYDFVLKWA 295 >gb|EOX95810.1| POZ/BTB containin G-protein 1 isoform 6 [Theobroma cacao] Length = 525 Score = 55.8 bits (133), Expect = 9e-06 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = -2 Query: 615 QEAAMALPLCAIEVVLGSDDLQLCSEDVVLDFILKWA 505 QE MALPL IE +L SDDLQ+ SED V DF+LKWA Sbjct: 257 QEEVMALPLAGIEAILSSDDLQIASEDAVYDFVLKWA 293 >gb|EOX95809.1| POZ/BTB containin G-protein 1 isoform 5 [Theobroma cacao] Length = 380 Score = 55.8 bits (133), Expect = 9e-06 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = -2 Query: 615 QEAAMALPLCAIEVVLGSDDLQLCSEDVVLDFILKWA 505 QE MALPL IE +L SDDLQ+ SED V DF+LKWA Sbjct: 112 QEEVMALPLAGIEAILSSDDLQIASEDAVYDFVLKWA 148 >gb|EOX95808.1| POZ/BTB containin G-protein 1 isoform 4 [Theobroma cacao] Length = 413 Score = 55.8 bits (133), Expect = 9e-06 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = -2 Query: 615 QEAAMALPLCAIEVVLGSDDLQLCSEDVVLDFILKWA 505 QE MALPL IE +L SDDLQ+ SED V DF+LKWA Sbjct: 145 QEEVMALPLAGIEAILSSDDLQIASEDAVYDFVLKWA 181 >gb|EOX95807.1| POZ/BTB containin G-protein 1 isoform 3 [Theobroma cacao] Length = 468 Score = 55.8 bits (133), Expect = 9e-06 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = -2 Query: 615 QEAAMALPLCAIEVVLGSDDLQLCSEDVVLDFILKWA 505 QE MALPL IE +L SDDLQ+ SED V DF+LKWA Sbjct: 200 QEEVMALPLAGIEAILSSDDLQIASEDAVYDFVLKWA 236 >gb|EOX95806.1| POZ/BTB containin G-protein 1 isoform 2 [Theobroma cacao] Length = 460 Score = 55.8 bits (133), Expect = 9e-06 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = -2 Query: 615 QEAAMALPLCAIEVVLGSDDLQLCSEDVVLDFILKWA 505 QE MALPL IE +L SDDLQ+ SED V DF+LKWA Sbjct: 192 QEEVMALPLAGIEAILSSDDLQIASEDAVYDFVLKWA 228 >gb|EOX95805.1| POZ/BTB containin G-protein 1 isoform 1 [Theobroma cacao] Length = 552 Score = 55.8 bits (133), Expect = 9e-06 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = -2 Query: 615 QEAAMALPLCAIEVVLGSDDLQLCSEDVVLDFILKWA 505 QE MALPL IE +L SDDLQ+ SED V DF+LKWA Sbjct: 284 QEEVMALPLAGIEAILSSDDLQIASEDAVYDFVLKWA 320 >emb|CBI40464.3| unnamed protein product [Vitis vinifera] Length = 501 Score = 55.8 bits (133), Expect = 9e-06 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = -2 Query: 615 QEAAMALPLCAIEVVLGSDDLQLCSEDVVLDFILKWA 505 QE MALPL IE VL SDDLQ+ SED V DF+LKWA Sbjct: 233 QEEVMALPLAGIEAVLSSDDLQVASEDAVYDFVLKWA 269 >ref|XP_002279915.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Vitis vinifera] Length = 553 Score = 55.8 bits (133), Expect = 9e-06 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = -2 Query: 615 QEAAMALPLCAIEVVLGSDDLQLCSEDVVLDFILKWA 505 QE MALPL IE VL SDDLQ+ SED V DF+LKWA Sbjct: 285 QEEVMALPLAGIEAVLSSDDLQVASEDAVYDFVLKWA 321