BLASTX nr result
ID: Rheum21_contig00036611
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00036611 (485 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279773.2| PREDICTED: regulator of telomere elongation ... 68 1e-09 gb|EOY26738.1| Regulator of telomere elongation helicase 1 rtel1... 63 4e-08 ref|XP_006465547.1| PREDICTED: regulator of telomere elongation ... 62 6e-08 ref|XP_006465546.1| PREDICTED: regulator of telomere elongation ... 62 6e-08 ref|XP_004235709.1| PREDICTED: regulator of telomere elongation ... 61 1e-07 ref|XP_002528200.1| regulator of telomere elongation helicase 1 ... 59 9e-07 ref|XP_004486727.1| PREDICTED: regulator of telomere elongation ... 58 1e-06 ref|XP_004486726.1| PREDICTED: regulator of telomere elongation ... 58 1e-06 ref|XP_003597782.1| Regulator of telomere elongation helicase [M... 58 1e-06 ref|XP_003597775.1| Regulator of telomere elongation helicase [M... 58 1e-06 gb|ESW22658.1| hypothetical protein PHAVU_005G171300g [Phaseolus... 55 7e-06 >ref|XP_002279773.2| PREDICTED: regulator of telomere elongation helicase 1-like [Vitis vinifera] Length = 1084 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/53 (58%), Positives = 42/53 (79%) Frame = +2 Query: 2 KIGTVMQSIVRLFSTAERLPLLRRFKDYIPQKYRPLYEQHCASAEEDVGTKKN 160 KIG V++SI RLFS ERLPLL+RFKDYIP KY+ LY+Q+ + EE + T+++ Sbjct: 1004 KIGQVLESIARLFSGPERLPLLKRFKDYIPAKYQSLYQQYLKNNEETIDTEES 1056 >gb|EOY26738.1| Regulator of telomere elongation helicase 1 rtel1, putative isoform 1 [Theobroma cacao] Length = 1052 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/53 (56%), Positives = 39/53 (73%) Frame = +2 Query: 2 KIGTVMQSIVRLFSTAERLPLLRRFKDYIPQKYRPLYEQHCASAEEDVGTKKN 160 KI V+QSIV LFS ERLPLL RFKDY+P KY+ LYEQ+ +++E ++N Sbjct: 1000 KISNVLQSIVGLFSGPERLPLLERFKDYVPAKYQSLYEQYIETSKEMPDNQRN 1052 >ref|XP_006465547.1| PREDICTED: regulator of telomere elongation helicase 1-like isoform X2 [Citrus sinensis] Length = 1032 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = +2 Query: 2 KIGTVMQSIVRLFSTAERLPLLRRFKDYIPQKYRPLYEQH 121 KI V+QSI +LF+ ERLPLLRRFKDY+P KY PLYEQ+ Sbjct: 988 KISHVLQSIAKLFAGPERLPLLRRFKDYVPAKYHPLYEQY 1027 >ref|XP_006465546.1| PREDICTED: regulator of telomere elongation helicase 1-like isoform X1 [Citrus sinensis] Length = 1036 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = +2 Query: 2 KIGTVMQSIVRLFSTAERLPLLRRFKDYIPQKYRPLYEQH 121 KI V+QSI +LF+ ERLPLLRRFKDY+P KY PLYEQ+ Sbjct: 992 KISHVLQSIAKLFAGPERLPLLRRFKDYVPAKYHPLYEQY 1031 >ref|XP_004235709.1| PREDICTED: regulator of telomere elongation helicase 1-like [Solanum lycopersicum] Length = 1036 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = +2 Query: 2 KIGTVMQSIVRLFSTAERLPLLRRFKDYIPQKYRPLYEQHCASAEE 139 KIG V+QSI RLFS +RLPLL RFKDY+P KY LY+Q+ +E Sbjct: 987 KIGQVLQSITRLFSLPDRLPLLHRFKDYVPAKYHSLYDQYLKRNQE 1032 >ref|XP_002528200.1| regulator of telomere elongation helicase 1 rtel1, putative [Ricinus communis] gi|223532412|gb|EEF34207.1| regulator of telomere elongation helicase 1 rtel1, putative [Ricinus communis] Length = 1049 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/52 (50%), Positives = 38/52 (73%) Frame = +2 Query: 2 KIGTVMQSIVRLFSTAERLPLLRRFKDYIPQKYRPLYEQHCASAEEDVGTKK 157 +IG+V++SIV+LFS +R PLL+RFKDYIP KY LYE + + + + +K Sbjct: 966 QIGSVLESIVKLFSGPDRFPLLKRFKDYIPAKYHSLYEHYLEATDRRLDHQK 1017 >ref|XP_004486727.1| PREDICTED: regulator of telomere elongation helicase 1-like isoform X2 [Cicer arietinum] Length = 1009 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +2 Query: 2 KIGTVMQSIVRLFSTAERLPLLRRFKDYIPQKYRPLYEQH 121 KI V+ SI RLFS ERLPLL+RFKDYIP KY LYEQ+ Sbjct: 964 KISEVLLSISRLFSGPERLPLLKRFKDYIPAKYHSLYEQY 1003 >ref|XP_004486726.1| PREDICTED: regulator of telomere elongation helicase 1-like isoform X1 [Cicer arietinum] Length = 1006 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +2 Query: 2 KIGTVMQSIVRLFSTAERLPLLRRFKDYIPQKYRPLYEQH 121 KI V+ SI RLFS ERLPLL+RFKDYIP KY LYEQ+ Sbjct: 961 KISEVLLSISRLFSGPERLPLLKRFKDYIPAKYHSLYEQY 1000 >ref|XP_003597782.1| Regulator of telomere elongation helicase [Medicago truncatula] gi|355486830|gb|AES68033.1| Regulator of telomere elongation helicase [Medicago truncatula] Length = 1089 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +2 Query: 2 KIGTVMQSIVRLFSTAERLPLLRRFKDYIPQKYRPLYEQH 121 KI V+ SI RLFS ERLPLL+RFKDYIP KY LYEQ+ Sbjct: 1027 KISEVLLSISRLFSGPERLPLLKRFKDYIPAKYHSLYEQY 1066 >ref|XP_003597775.1| Regulator of telomere elongation helicase [Medicago truncatula] gi|355486823|gb|AES68026.1| Regulator of telomere elongation helicase [Medicago truncatula] Length = 1048 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +2 Query: 2 KIGTVMQSIVRLFSTAERLPLLRRFKDYIPQKYRPLYEQH 121 KI V+ SI RLFS ERLPLL+RFKDYIP KY LYEQ+ Sbjct: 986 KISEVLLSISRLFSGPERLPLLKRFKDYIPAKYHSLYEQY 1025 >gb|ESW22658.1| hypothetical protein PHAVU_005G171300g [Phaseolus vulgaris] Length = 971 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = +2 Query: 2 KIGTVMQSIVRLFSTAERLPLLRRFKDYIPQKYRPLYEQH 121 KI V+Q I RLFS +RLPLL+RFKDYIP KY LYE + Sbjct: 924 KISEVLQCISRLFSGPDRLPLLKRFKDYIPAKYHSLYEHY 963