BLASTX nr result
ID: Rheum21_contig00036350
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00036350 (558 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004296926.1| PREDICTED: uncharacterized protein LOC101310... 87 3e-15 gb|EXB55016.1| hypothetical protein L484_007347 [Morus notabilis] 87 4e-15 gb|ESW19747.1| hypothetical protein PHAVU_006G152100g [Phaseolus... 87 4e-15 ref|XP_006352779.1| PREDICTED: uncharacterized protein LOC102598... 86 5e-15 ref|XP_006349228.1| PREDICTED: uncharacterized protein LOC102584... 86 5e-15 gb|EMJ26964.1| hypothetical protein PRUPE_ppa005540mg [Prunus pe... 86 5e-15 ref|XP_004229426.1| PREDICTED: uncharacterized protein LOC101252... 86 5e-15 gb|EMJ01036.1| hypothetical protein PRUPE_ppa005573mg [Prunus pe... 86 6e-15 emb|CBI32367.3| unnamed protein product [Vitis vinifera] 86 6e-15 ref|XP_002272356.1| PREDICTED: uncharacterized protein LOC100249... 86 6e-15 emb|CAN62851.1| hypothetical protein VITISV_010155 [Vitis vinifera] 86 6e-15 ref|XP_003541625.2| PREDICTED: protein YLS7-like [Glycine max] 86 8e-15 gb|AGE32507.1| hypothetical protein 816152, partial [Populus pru... 86 8e-15 gb|AGE32506.1| hypothetical protein 816152, partial [Populus pru... 86 8e-15 ref|XP_004242331.1| PREDICTED: uncharacterized protein LOC101251... 86 8e-15 ref|XP_002302119.1| hypothetical protein POPTR_0002s05540g [Popu... 85 1e-14 ref|XP_003547244.1| PREDICTED: protein YLS7-like isoform X1 [Gly... 84 2e-14 gb|AFK35624.1| unknown [Lotus japonicus] 83 5e-14 gb|EXB39355.1| hypothetical protein L484_025050 [Morus notabilis] 82 7e-14 ref|XP_006479739.1| PREDICTED: protein YLS7-like isoform X1 [Cit... 82 9e-14 >ref|XP_004296926.1| PREDICTED: uncharacterized protein LOC101310689 [Fragaria vesca subsp. vesca] Length = 463 Score = 87.0 bits (214), Expect = 3e-15 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -3 Query: 556 SLYYLGPNKGPASLRRQDCSHWCLPGVPDTWNELLYALYLKRD 428 SLYYLGP PAS+RRQDCSHWCLPGVPDTWNELLYAL+LK + Sbjct: 398 SLYYLGPKLSPASIRRQDCSHWCLPGVPDTWNELLYALFLKHE 440 >gb|EXB55016.1| hypothetical protein L484_007347 [Morus notabilis] Length = 458 Score = 86.7 bits (213), Expect = 4e-15 Identities = 36/43 (83%), Positives = 38/43 (88%) Frame = -3 Query: 556 SLYYLGPNKGPASLRRQDCSHWCLPGVPDTWNELLYALYLKRD 428 SLYYLGPN GP S RQDCSHWCLPGVPDTWNELLYAL+LK + Sbjct: 398 SLYYLGPNMGPVSPHRQDCSHWCLPGVPDTWNELLYALFLKHE 440 >gb|ESW19747.1| hypothetical protein PHAVU_006G152100g [Phaseolus vulgaris] Length = 544 Score = 86.7 bits (213), Expect = 4e-15 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = -3 Query: 556 SLYYLGPNKGPASLRRQDCSHWCLPGVPDTWNELLYALYLKRD 428 S+YYLGPN GP L RQDCSHWCLPGVPDTWNELLYAL+LK + Sbjct: 496 SIYYLGPNAGPTPLHRQDCSHWCLPGVPDTWNELLYALFLKHE 538 >ref|XP_006352779.1| PREDICTED: uncharacterized protein LOC102598636 isoform X1 [Solanum tuberosum] gi|565372396|ref|XP_006352780.1| PREDICTED: uncharacterized protein LOC102598636 isoform X2 [Solanum tuberosum] Length = 451 Score = 86.3 bits (212), Expect = 5e-15 Identities = 36/43 (83%), Positives = 38/43 (88%) Frame = -3 Query: 556 SLYYLGPNKGPASLRRQDCSHWCLPGVPDTWNELLYALYLKRD 428 SLYYLGP GPA L RQDCSHWCLPGVPDTWNELLYA +LKR+ Sbjct: 398 SLYYLGPKVGPAPLHRQDCSHWCLPGVPDTWNELLYATFLKRE 440 >ref|XP_006349228.1| PREDICTED: uncharacterized protein LOC102584626 [Solanum tuberosum] Length = 451 Score = 86.3 bits (212), Expect = 5e-15 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -3 Query: 556 SLYYLGPNKGPASLRRQDCSHWCLPGVPDTWNELLYALYLKRD 428 S+YYLGPN GPA + RQDCSHWCLPGVPD WNELLYAL++KR+ Sbjct: 396 SMYYLGPNVGPAPINRQDCSHWCLPGVPDAWNELLYALFMKRE 438 >gb|EMJ26964.1| hypothetical protein PRUPE_ppa005540mg [Prunus persica] Length = 455 Score = 86.3 bits (212), Expect = 5e-15 Identities = 36/43 (83%), Positives = 38/43 (88%) Frame = -3 Query: 556 SLYYLGPNKGPASLRRQDCSHWCLPGVPDTWNELLYALYLKRD 428 SLYYLGP GPA L RQDCSHWCLPGVPDTWNELLYAL+LK + Sbjct: 399 SLYYLGPKVGPAPLHRQDCSHWCLPGVPDTWNELLYALFLKHE 441 >ref|XP_004229426.1| PREDICTED: uncharacterized protein LOC101252430 [Solanum lycopersicum] Length = 451 Score = 86.3 bits (212), Expect = 5e-15 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -3 Query: 556 SLYYLGPNKGPASLRRQDCSHWCLPGVPDTWNELLYALYLKRD 428 S+YYLGPN GPA + RQDCSHWCLPGVPD WNELLYAL++KR+ Sbjct: 396 SMYYLGPNVGPAPINRQDCSHWCLPGVPDAWNELLYALFMKRE 438 >gb|EMJ01036.1| hypothetical protein PRUPE_ppa005573mg [Prunus persica] Length = 454 Score = 85.9 bits (211), Expect = 6e-15 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -3 Query: 556 SLYYLGPNKGPASLRRQDCSHWCLPGVPDTWNELLYALYLKRD 428 S+YYLGP GPAS++ QDCSHWCLPGVPD WNELLYAL+LKR+ Sbjct: 401 SIYYLGPETGPASIKHQDCSHWCLPGVPDAWNELLYALFLKRE 443 >emb|CBI32367.3| unnamed protein product [Vitis vinifera] Length = 419 Score = 85.9 bits (211), Expect = 6e-15 Identities = 37/63 (58%), Positives = 44/63 (69%) Frame = -3 Query: 556 SLYYLGPNKGPASLRRQDCSHWCLPGVPDTWNELLYALYLKRDXXXXXXXXXXX*TNKPN 377 S+YYLGP GPA L RQDCSHWCLPGVPD+WNELLYAL+LKR+ + +P+ Sbjct: 356 SVYYLGPGLGPAPLHRQDCSHWCLPGVPDSWNELLYALFLKRESIRTRNSTSTQNSTEPS 415 Query: 376 PLQ 368 Q Sbjct: 416 AAQ 418 >ref|XP_002272356.1| PREDICTED: uncharacterized protein LOC100249456 [Vitis vinifera] Length = 460 Score = 85.9 bits (211), Expect = 6e-15 Identities = 37/63 (58%), Positives = 44/63 (69%) Frame = -3 Query: 556 SLYYLGPNKGPASLRRQDCSHWCLPGVPDTWNELLYALYLKRDXXXXXXXXXXX*TNKPN 377 S+YYLGP GPA L RQDCSHWCLPGVPD+WNELLYAL+LKR+ + +P+ Sbjct: 397 SVYYLGPGLGPAPLHRQDCSHWCLPGVPDSWNELLYALFLKRESIRTRNSTSTQNSTEPS 456 Query: 376 PLQ 368 Q Sbjct: 457 AAQ 459 >emb|CAN62851.1| hypothetical protein VITISV_010155 [Vitis vinifera] Length = 463 Score = 85.9 bits (211), Expect = 6e-15 Identities = 37/63 (58%), Positives = 44/63 (69%) Frame = -3 Query: 556 SLYYLGPNKGPASLRRQDCSHWCLPGVPDTWNELLYALYLKRDXXXXXXXXXXX*TNKPN 377 S+YYLGP GPA L RQDCSHWCLPGVPD+WNELLYAL+LKR+ + +P+ Sbjct: 400 SVYYLGPGLGPAXLHRQDCSHWCLPGVPDSWNELLYALFLKRESIRTRNSTSTQNSTEPS 459 Query: 376 PLQ 368 Q Sbjct: 460 AAQ 462 >ref|XP_003541625.2| PREDICTED: protein YLS7-like [Glycine max] Length = 452 Score = 85.5 bits (210), Expect = 8e-15 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = -3 Query: 556 SLYYLGPNKGPASLRRQDCSHWCLPGVPDTWNELLYALYLKRD 428 S+YYLGPN GPA RQDCSHWCLPGVPDTWNELLYAL+LK + Sbjct: 404 SIYYLGPNAGPAPPHRQDCSHWCLPGVPDTWNELLYALFLKHE 446 >gb|AGE32507.1| hypothetical protein 816152, partial [Populus pruinosa] gi|447387007|gb|AGE32509.1| hypothetical protein 816152, partial [Populus pruinosa] gi|447387011|gb|AGE32511.1| hypothetical protein 816152, partial [Populus pruinosa] gi|447387013|gb|AGE32512.1| hypothetical protein 816152, partial [Populus pruinosa] gi|447387015|gb|AGE32513.1| hypothetical protein 816152, partial [Populus pruinosa] gi|447387017|gb|AGE32514.1| hypothetical protein 816152, partial [Populus pruinosa] gi|447387019|gb|AGE32515.1| hypothetical protein 816152, partial [Populus pruinosa] gi|447387021|gb|AGE32516.1| hypothetical protein 816152, partial [Populus pruinosa] gi|447387023|gb|AGE32517.1| hypothetical protein 816152, partial [Populus pruinosa] gi|447387025|gb|AGE32518.1| hypothetical protein 816152, partial [Populus pruinosa] gi|447387027|gb|AGE32519.1| hypothetical protein 816152, partial [Populus pruinosa] gi|447387029|gb|AGE32520.1| hypothetical protein 816152, partial [Populus pruinosa] gi|447387031|gb|AGE32521.1| hypothetical protein 816152, partial [Populus pruinosa] gi|447387033|gb|AGE32522.1| hypothetical protein 816152, partial [Populus pruinosa] gi|447387035|gb|AGE32523.1| hypothetical protein 816152, partial [Populus pruinosa] gi|447387037|gb|AGE32524.1| hypothetical protein 816152, partial [Populus pruinosa] gi|447387039|gb|AGE32525.1| hypothetical protein 816152, partial [Populus pruinosa] gi|447387041|gb|AGE32526.1| hypothetical protein 816152, partial [Populus pruinosa] gi|447387043|gb|AGE32527.1| hypothetical protein 816152, partial [Populus pruinosa] gi|447387045|gb|AGE32528.1| hypothetical protein 816152, partial [Populus pruinosa] gi|447387047|gb|AGE32529.1| hypothetical protein 816152, partial [Populus pruinosa] gi|447387049|gb|AGE32530.1| hypothetical protein 816152, partial [Populus pruinosa] gi|447387051|gb|AGE32531.1| hypothetical protein 816152, partial [Populus pruinosa] gi|447387053|gb|AGE32532.1| hypothetical protein 816152, partial [Populus pruinosa] gi|447387055|gb|AGE32533.1| hypothetical protein 816152, partial [Populus pruinosa] gi|447387272|gb|AGE32610.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387274|gb|AGE32611.1| hypothetical protein 816152, partial [Populus euphratica] Length = 93 Score = 85.5 bits (210), Expect = 8e-15 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -3 Query: 556 SLYYLGPNKGPASLRRQDCSHWCLPGVPDTWNELLYALYLKRD 428 SLYYLGP +GPASL RQDCSHWCLPGVPD+WNELLY L LK++ Sbjct: 33 SLYYLGPGRGPASLHRQDCSHWCLPGVPDSWNELLYTLILKQE 75 >gb|AGE32506.1| hypothetical protein 816152, partial [Populus pruinosa] gi|447387005|gb|AGE32508.1| hypothetical protein 816152, partial [Populus pruinosa] gi|447387009|gb|AGE32510.1| hypothetical protein 816152, partial [Populus pruinosa] gi|447387276|gb|AGE32612.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387278|gb|AGE32613.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387280|gb|AGE32614.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387282|gb|AGE32615.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387284|gb|AGE32616.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387286|gb|AGE32617.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387288|gb|AGE32618.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387290|gb|AGE32619.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387292|gb|AGE32620.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387294|gb|AGE32621.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387296|gb|AGE32622.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387298|gb|AGE32623.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387300|gb|AGE32624.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387302|gb|AGE32625.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387304|gb|AGE32626.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387306|gb|AGE32627.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387308|gb|AGE32628.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387310|gb|AGE32629.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387312|gb|AGE32630.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387314|gb|AGE32631.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387316|gb|AGE32632.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387318|gb|AGE32633.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387320|gb|AGE32634.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387322|gb|AGE32635.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387324|gb|AGE32636.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387326|gb|AGE32637.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387328|gb|AGE32638.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387330|gb|AGE32639.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387332|gb|AGE32640.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387334|gb|AGE32641.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387336|gb|AGE32642.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387338|gb|AGE32643.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387340|gb|AGE32644.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387342|gb|AGE32645.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387344|gb|AGE32646.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387346|gb|AGE32647.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387348|gb|AGE32648.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387350|gb|AGE32649.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387352|gb|AGE32650.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387354|gb|AGE32651.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387356|gb|AGE32652.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387358|gb|AGE32653.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387360|gb|AGE32654.1| hypothetical protein 816152, partial [Populus euphratica] gi|447387362|gb|AGE32655.1| hypothetical protein 816152, partial [Populus euphratica] Length = 93 Score = 85.5 bits (210), Expect = 8e-15 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -3 Query: 556 SLYYLGPNKGPASLRRQDCSHWCLPGVPDTWNELLYALYLKRD 428 SLYYLGP +GPASL RQDCSHWCLPGVPD+WNELLY L LK++ Sbjct: 33 SLYYLGPGRGPASLHRQDCSHWCLPGVPDSWNELLYTLLLKQE 75 >ref|XP_004242331.1| PREDICTED: uncharacterized protein LOC101251789 [Solanum lycopersicum] Length = 449 Score = 85.5 bits (210), Expect = 8e-15 Identities = 36/43 (83%), Positives = 38/43 (88%) Frame = -3 Query: 556 SLYYLGPNKGPASLRRQDCSHWCLPGVPDTWNELLYALYLKRD 428 SLYYLGP GPA L RQDCSHWCLPGVPDTWNELLYA +LKR+ Sbjct: 396 SLYYLGPKVGPAPLHRQDCSHWCLPGVPDTWNELLYANFLKRE 438 >ref|XP_002302119.1| hypothetical protein POPTR_0002s05540g [Populus trichocarpa] gi|222843845|gb|EEE81392.1| hypothetical protein POPTR_0002s05540g [Populus trichocarpa] Length = 515 Score = 84.7 bits (208), Expect = 1e-14 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = -3 Query: 556 SLYYLGPNKGPASLRRQDCSHWCLPGVPDTWNELLYALYLKRD 428 SLYYLGP GPASL RQDCSHWCLPGVPD+WNELLY L LK++ Sbjct: 455 SLYYLGPGSGPASLHRQDCSHWCLPGVPDSWNELLYTLLLKQE 497 >ref|XP_003547244.1| PREDICTED: protein YLS7-like isoform X1 [Glycine max] gi|571517657|ref|XP_006597575.1| PREDICTED: protein YLS7-like isoform X2 [Glycine max] gi|571517660|ref|XP_006597576.1| PREDICTED: protein YLS7-like isoform X3 [Glycine max] Length = 439 Score = 84.0 bits (206), Expect = 2e-14 Identities = 35/43 (81%), Positives = 37/43 (86%) Frame = -3 Query: 556 SLYYLGPNKGPASLRRQDCSHWCLPGVPDTWNELLYALYLKRD 428 S+YYLGPN GPA RQDCSHWCLPGVPDTWNELLYAL LK + Sbjct: 391 SIYYLGPNAGPAPPHRQDCSHWCLPGVPDTWNELLYALLLKHE 433 >gb|AFK35624.1| unknown [Lotus japonicus] Length = 447 Score = 82.8 bits (203), Expect = 5e-14 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = -3 Query: 553 LYYLGPNKGPASLRRQDCSHWCLPGVPDTWNELLYALYLKRD 428 +YYLGP+ G A+L RQDCSHWCLPGVPDTWNELLYAL+LK++ Sbjct: 402 IYYLGPDAGTAALHRQDCSHWCLPGVPDTWNELLYALFLKQE 443 >gb|EXB39355.1| hypothetical protein L484_025050 [Morus notabilis] Length = 473 Score = 82.4 bits (202), Expect = 7e-14 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = -3 Query: 556 SLYYLGPNKGPASLRRQDCSHWCLPGVPDTWNELLYALYLKRD 428 S+YYLGP GPAS R QDCSHWCLPGVPD WNELLY ++LK++ Sbjct: 416 SIYYLGPRNGPASFRHQDCSHWCLPGVPDIWNELLYVVFLKKE 458 >ref|XP_006479739.1| PREDICTED: protein YLS7-like isoform X1 [Citrus sinensis] Length = 476 Score = 82.0 bits (201), Expect = 9e-14 Identities = 32/43 (74%), Positives = 39/43 (90%) Frame = -3 Query: 556 SLYYLGPNKGPASLRRQDCSHWCLPGVPDTWNELLYALYLKRD 428 S+Y LGP +GPA L RQDCSHWCLPG+PD+WNELLYAL+LK++ Sbjct: 419 SVYLLGPKRGPAPLHRQDCSHWCLPGIPDSWNELLYALFLKQE 461