BLASTX nr result
ID: Rheum21_contig00035452
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00035452 (283 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518274.1| conserved hypothetical protein [Ricinus comm... 74 2e-11 emb|CAN71465.1| hypothetical protein VITISV_038986 [Vitis vinifera] 49 3e-08 >ref|XP_002518274.1| conserved hypothetical protein [Ricinus communis] gi|223542494|gb|EEF44034.1| conserved hypothetical protein [Ricinus communis] Length = 431 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -2 Query: 282 CTMFRFTDKEDRVGVGVYDMRLKYDPRRYMLTMGRKQEALFK 157 CTMFRFTDKEDRV VGVY++ LKYDP RYMLTMGRKQE L K Sbjct: 390 CTMFRFTDKEDRVRVGVYNVILKYDPGRYMLTMGRKQEPLCK 431 >emb|CAN71465.1| hypothetical protein VITISV_038986 [Vitis vinifera] Length = 564 Score = 49.3 bits (116), Expect(2) = 3e-08 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +3 Query: 6 PPTDRSTPITLRTVQDSYRLSYGFLTS 86 PPTDRSTPIT RTVQDSY LSYG+L++ Sbjct: 302 PPTDRSTPITPRTVQDSYHLSYGWLSN 328 Score = 34.3 bits (77), Expect(2) = 3e-08 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +2 Query: 74 LSNFTSFSGRSALSIDG*YKRSVTSRNS 157 LSNFTSFSGRSALSID R++ R S Sbjct: 326 LSNFTSFSGRSALSID--VNRNIVHRYS 351