BLASTX nr result
ID: Rheum21_contig00033142
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00033142 (334 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC20032.1| Protein UXT-like protein [Morus notabilis] 60 4e-07 ref|XP_006438761.1| hypothetical protein CICLE_v10032989mg [Citr... 58 1e-06 ref|XP_004158996.1| PREDICTED: protein UXT homolog [Cucumis sati... 55 7e-06 ref|XP_004141760.1| PREDICTED: protein UXT homolog [Cucumis sati... 55 7e-06 ref|XP_002522491.1| protein binding protein, putative [Ricinus c... 55 7e-06 >gb|EXC20032.1| Protein UXT-like protein [Morus notabilis] Length = 265 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = +1 Query: 220 MDRYREEKINQCEEFLERRLKPALVRTIADRDKVFEQQ 333 MD YR+EKI + EEF++RRLKP L+R IA+RDKVFEQQ Sbjct: 77 MDSYRQEKIQKFEEFVDRRLKPDLIRAIAERDKVFEQQ 114 >ref|XP_006438761.1| hypothetical protein CICLE_v10032989mg [Citrus clementina] gi|567892483|ref|XP_006438762.1| hypothetical protein CICLE_v10032989mg [Citrus clementina] gi|568859128|ref|XP_006483094.1| PREDICTED: protein UXT homolog isoform X1 [Citrus sinensis] gi|568859130|ref|XP_006483095.1| PREDICTED: protein UXT homolog isoform X2 [Citrus sinensis] gi|557540957|gb|ESR52001.1| hypothetical protein CICLE_v10032989mg [Citrus clementina] gi|557540958|gb|ESR52002.1| hypothetical protein CICLE_v10032989mg [Citrus clementina] Length = 151 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = +1 Query: 220 MDRYREEKINQCEEFLERRLKPALVRTIADRDKVFEQQ 333 MD YR+EK+ + EEF++RRLKP L R IA+RDKVFEQQ Sbjct: 1 MDSYRQEKVQKFEEFVDRRLKPDLTRAIAERDKVFEQQ 38 >ref|XP_004158996.1| PREDICTED: protein UXT homolog [Cucumis sativus] Length = 155 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = +1 Query: 211 DLPMDRYREEKINQCEEFLERRLKPALVRTIADRDKVFEQQ 333 D+ D +R EK+ + EEF++RRLKP LV IA+RDKVFEQQ Sbjct: 2 DVVTDNFRHEKVQRFEEFVDRRLKPDLVHAIAERDKVFEQQ 42 >ref|XP_004141760.1| PREDICTED: protein UXT homolog [Cucumis sativus] Length = 155 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = +1 Query: 211 DLPMDRYREEKINQCEEFLERRLKPALVRTIADRDKVFEQQ 333 D+ D +R EK+ + EEF++RRLKP LV IA+RDKVFEQQ Sbjct: 2 DVVTDNFRHEKVQRFEEFVDRRLKPDLVHAIAERDKVFEQQ 42 >ref|XP_002522491.1| protein binding protein, putative [Ricinus communis] gi|223538376|gb|EEF39983.1| protein binding protein, putative [Ricinus communis] Length = 210 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = +1 Query: 220 MDRYREEKINQCEEFLERRLKPALVRTIADRDKVFEQQ 333 M+ YR++KI + EEF++RRLKP LVR IA RDKVFE+Q Sbjct: 1 MESYRQDKIQKFEEFVDRRLKPDLVRAIAQRDKVFEEQ 38