BLASTX nr result
ID: Rheum21_contig00032861
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00032861 (302 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518258.1| conserved hypothetical protein [Ricinus comm... 65 9e-09 >ref|XP_002518258.1| conserved hypothetical protein [Ricinus communis] gi|223542605|gb|EEF44144.1| conserved hypothetical protein [Ricinus communis] Length = 213 Score = 65.1 bits (157), Expect = 9e-09 Identities = 31/40 (77%), Positives = 32/40 (80%) Frame = +2 Query: 182 NKESFWTRQERNSPFDTKG*ELIAGDDLVKKIYERKFSNR 301 NK+SFW RQERNSPFDTK ELIAGDDLVK IYER R Sbjct: 120 NKDSFWARQERNSPFDTKRQELIAGDDLVKGIYERSAGTR 159