BLASTX nr result
ID: Rheum21_contig00032789
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00032789 (308 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514009.1| transcription factor, putative [Ricinus comm... 59 5e-07 ref|XP_006581501.1| PREDICTED: ZF-HD homeobox protein At4g24660-... 58 1e-06 ref|XP_002302329.1| hypothetical protein POPTR_0002s10330g [Popu... 58 1e-06 gb|EXB75566.1| hypothetical protein L484_026038 [Morus notabilis] 57 3e-06 ref|XP_004957068.1| PREDICTED: ZF-HD homeobox protein At4g24660-... 57 3e-06 ref|XP_003576623.1| PREDICTED: ZF-HD homeobox protein At4g24660-... 57 3e-06 ref|XP_003574645.1| PREDICTED: ZF-HD homeobox protein At4g24660-... 57 3e-06 ref|XP_002460367.1| hypothetical protein SORBIDRAFT_02g027040 [S... 57 3e-06 ref|XP_006660219.1| PREDICTED: ZF-HD homeobox protein At4g24660-... 57 3e-06 ref|XP_006433874.1| hypothetical protein CICLE_v10002355mg [Citr... 57 3e-06 ref|XP_004973708.1| PREDICTED: ZF-HD homeobox protein At4g24660-... 57 3e-06 tpg|DAA48505.1| TPA: putative homeobox DNA-binding domain superf... 57 3e-06 tpg|DAA40283.1| TPA: putative homeobox DNA-binding domain superf... 57 3e-06 ref|XP_002445649.1| hypothetical protein SORBIDRAFT_07g023360 [S... 57 3e-06 ref|NP_001151888.1| ZF-HD protein dimerisation region containing... 57 3e-06 ref|NP_001149424.1| LOC100283050 [Zea mays] gi|195627130|gb|ACG3... 57 3e-06 emb|CAC34447.1| ZF-HD homeobox protein [Flaveria bidentis] 56 6e-06 emb|CBI19232.3| unnamed protein product [Vitis vinifera] 56 6e-06 ref|XP_002285709.1| PREDICTED: ZF-HD homeobox protein At4g24660 ... 56 6e-06 emb|CAN75153.1| hypothetical protein VITISV_035994 [Vitis vinifera] 56 6e-06 >ref|XP_002514009.1| transcription factor, putative [Ricinus communis] gi|223547095|gb|EEF48592.1| transcription factor, putative [Ricinus communis] Length = 270 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 308 AAVEQFCSELRLSRQVLKVWLHNNKHTLGRKP 213 AAVEQFCS+ + RQVLKVW+HNNKHTLG+KP Sbjct: 239 AAVEQFCSDNGIKRQVLKVWMHNNKHTLGKKP 270 >ref|XP_006581501.1| PREDICTED: ZF-HD homeobox protein At4g24660-like isoform X2 [Glycine max] Length = 275 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 308 AAVEQFCSELRLSRQVLKVWLHNNKHTLGRKP 213 AAVEQFC+E + R VLKVW+HNNKHTLG+KP Sbjct: 244 AAVEQFCAETCIKRHVLKVWMHNNKHTLGKKP 275 >ref|XP_002302329.1| hypothetical protein POPTR_0002s10330g [Populus trichocarpa] gi|222844055|gb|EEE81602.1| hypothetical protein POPTR_0002s10330g [Populus trichocarpa] Length = 262 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 308 AAVEQFCSELRLSRQVLKVWLHNNKHTLGRKP 213 AAVEQFC+E + R VLKVW+HNNKHTLG+KP Sbjct: 231 AAVEQFCAETGVKRHVLKVWMHNNKHTLGKKP 262 >gb|EXB75566.1| hypothetical protein L484_026038 [Morus notabilis] Length = 258 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 308 AAVEQFCSELRLSRQVLKVWLHNNKHTLGRKP 213 AAVEQFC+E + R VLKVW+HNNKHTLG+KP Sbjct: 227 AAVEQFCAETGVRRPVLKVWMHNNKHTLGKKP 258 >ref|XP_004957068.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Setaria italica] Length = 281 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 308 AAVEQFCSELRLSRQVLKVWLHNNKHTLGRKP 213 AAV+QFC E+ + R VLKVW+HNNKHTLG+KP Sbjct: 250 AAVQQFCDEVGVKRHVLKVWMHNNKHTLGKKP 281 >ref|XP_003576623.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Brachypodium distachyon] Length = 290 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 308 AAVEQFCSELRLSRQVLKVWLHNNKHTLGRKP 213 AAV+QFC E+ + R VLKVW+HNNKHTLG+KP Sbjct: 257 AAVQQFCDEVGVKRHVLKVWMHNNKHTLGKKP 288 >ref|XP_003574645.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Brachypodium distachyon] Length = 304 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 308 AAVEQFCSELRLSRQVLKVWLHNNKHTLGRKP 213 AAV+QFC E+ + R VLKVW+HNNKHTLG+KP Sbjct: 271 AAVQQFCEEVGVKRHVLKVWMHNNKHTLGKKP 302 >ref|XP_002460367.1| hypothetical protein SORBIDRAFT_02g027040 [Sorghum bicolor] gi|241923744|gb|EER96888.1| hypothetical protein SORBIDRAFT_02g027040 [Sorghum bicolor] Length = 302 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 308 AAVEQFCSELRLSRQVLKVWLHNNKHTLGRKP 213 AAV+QFC E+ + R VLKVW+HNNKHTLG+KP Sbjct: 271 AAVQQFCDEVGVKRHVLKVWMHNNKHTLGKKP 302 >ref|XP_006660219.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Oryza brachyantha] Length = 290 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 308 AAVEQFCSELRLSRQVLKVWLHNNKHTLGRKP 213 AAV+QFC E+ + R VLKVW+HNNKHTLG+KP Sbjct: 259 AAVQQFCEEVCVKRHVLKVWMHNNKHTLGKKP 290 >ref|XP_006433874.1| hypothetical protein CICLE_v10002355mg [Citrus clementina] gi|568836991|ref|XP_006472516.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Citrus sinensis] gi|557535996|gb|ESR47114.1| hypothetical protein CICLE_v10002355mg [Citrus clementina] Length = 233 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 308 AAVEQFCSELRLSRQVLKVWLHNNKHTLGRKP 213 A+VEQFC+E + R VLKVW+HNNKHTLG+KP Sbjct: 202 ASVEQFCAETGVKRHVLKVWMHNNKHTLGKKP 233 >ref|XP_004973708.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Setaria italica] Length = 298 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 308 AAVEQFCSELRLSRQVLKVWLHNNKHTLGRKP 213 AAV+QFC E+ + R VLKVW+HNNKHTLG+KP Sbjct: 267 AAVQQFCEEVCVKRHVLKVWMHNNKHTLGKKP 298 >tpg|DAA48505.1| TPA: putative homeobox DNA-binding domain superfamily protein [Zea mays] Length = 308 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 308 AAVEQFCSELRLSRQVLKVWLHNNKHTLGRKP 213 AAV+QFC E+ + R VLKVW+HNNKHTLG+KP Sbjct: 277 AAVQQFCEEVCVKRHVLKVWMHNNKHTLGKKP 308 >tpg|DAA40283.1| TPA: putative homeobox DNA-binding domain superfamily protein [Zea mays] Length = 286 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 308 AAVEQFCSELRLSRQVLKVWLHNNKHTLGRKP 213 AAV+QFC E+ + R VLKVW+HNNKHTLG+KP Sbjct: 255 AAVQQFCDEVCVKRHVLKVWMHNNKHTLGKKP 286 >ref|XP_002445649.1| hypothetical protein SORBIDRAFT_07g023360 [Sorghum bicolor] gi|241941999|gb|EES15144.1| hypothetical protein SORBIDRAFT_07g023360 [Sorghum bicolor] Length = 311 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 308 AAVEQFCSELRLSRQVLKVWLHNNKHTLGRKP 213 AAV+QFC E+ + R VLKVW+HNNKHTLG+KP Sbjct: 280 AAVQQFCEEVCVKRHVLKVWMHNNKHTLGKKP 311 >ref|NP_001151888.1| ZF-HD protein dimerisation region containing protein [Zea mays] gi|195650611|gb|ACG44773.1| ZF-HD protein dimerisation region containing protein [Zea mays] Length = 273 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 308 AAVEQFCSELRLSRQVLKVWLHNNKHTLGRKP 213 AAV+QFC E+ + R VLKVW+HNNKHTLG+KP Sbjct: 242 AAVQQFCDEVCVKRHVLKVWMHNNKHTLGKKP 273 >ref|NP_001149424.1| LOC100283050 [Zea mays] gi|195627130|gb|ACG35395.1| ZF-HD protein dimerisation region containing protein [Zea mays] Length = 308 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 308 AAVEQFCSELRLSRQVLKVWLHNNKHTLGRKP 213 AAV+QFC E+ + R VLKVW+HNNKHTLG+KP Sbjct: 277 AAVQQFCEEVCVKRHVLKVWMHNNKHTLGKKP 308 >emb|CAC34447.1| ZF-HD homeobox protein [Flaveria bidentis] Length = 237 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = -1 Query: 308 AAVEQFCSELRLSRQVLKVWLHNNKHTLGRKP 213 AAV+QFC+E + R VLKVW+HNNKHT+G+KP Sbjct: 206 AAVQQFCNETGVKRHVLKVWMHNNKHTIGKKP 237 >emb|CBI19232.3| unnamed protein product [Vitis vinifera] Length = 246 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -1 Query: 308 AAVEQFCSELRLSRQVLKVWLHNNKHTLGRKP 213 AAV+QFC E + R VLKVW+HNNKHTLG+KP Sbjct: 215 AAVQQFCQETCVKRHVLKVWMHNNKHTLGKKP 246 >ref|XP_002285709.1| PREDICTED: ZF-HD homeobox protein At4g24660 [Vitis vinifera] Length = 230 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -1 Query: 308 AAVEQFCSELRLSRQVLKVWLHNNKHTLGRKP 213 AAV+QFC E + R VLKVW+HNNKHTLG+KP Sbjct: 199 AAVQQFCQETCVKRHVLKVWMHNNKHTLGKKP 230 >emb|CAN75153.1| hypothetical protein VITISV_035994 [Vitis vinifera] Length = 284 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -1 Query: 308 AAVEQFCSELRLSRQVLKVWLHNNKHTLGRKP 213 AAV+QFC E + R VLKVW+HNNKHTLG+KP Sbjct: 253 AAVQQFCQETCVKRHVLKVWMHNNKHTLGKKP 284