BLASTX nr result
ID: Rheum21_contig00032593
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00032593 (296 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006442194.1| hypothetical protein CICLE_v10020011mg [Citr... 80 4e-13 ref|XP_006442193.1| hypothetical protein CICLE_v10020011mg [Citr... 80 4e-13 emb|CBI24939.3| unnamed protein product [Vitis vinifera] 80 4e-13 ref|XP_006492786.1| PREDICTED: pentatricopeptide repeat-containi... 77 2e-12 ref|XP_002273156.2| PREDICTED: pentatricopeptide repeat-containi... 74 2e-11 gb|EXB68332.1| hypothetical protein L484_004678 [Morus notabilis] 71 2e-10 ref|XP_003544432.1| PREDICTED: pentatricopeptide repeat-containi... 70 3e-10 ref|XP_002517779.1| pentatricopeptide repeat-containing protein,... 70 4e-10 gb|EMJ20528.1| hypothetical protein PRUPE_ppa019225mg, partial [... 67 2e-09 gb|EXB68330.1| hypothetical protein L484_004676 [Morus notabilis] 67 3e-09 gb|ESW14490.1| hypothetical protein PHAVU_008G285500g [Phaseolus... 66 4e-09 gb|EOX96641.1| Tetratricopeptide repeat-like superfamily protein... 64 3e-08 gb|EOX96640.1| Tetratricopeptide repeat-like superfamily protein... 64 3e-08 ref|XP_004308684.1| PREDICTED: pentatricopeptide repeat-containi... 62 8e-08 ref|XP_006344375.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_004244962.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_004244961.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_004135941.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 ref|XP_003599420.1| Pentatricopeptide repeat-containing protein ... 60 4e-07 ref|XP_002877905.1| pentatricopeptide repeat-containing protein ... 56 4e-06 >ref|XP_006442194.1| hypothetical protein CICLE_v10020011mg [Citrus clementina] gi|557544456|gb|ESR55434.1| hypothetical protein CICLE_v10020011mg [Citrus clementina] Length = 338 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/60 (60%), Positives = 49/60 (81%) Frame = +2 Query: 2 GDLDKMNKLFSSMKEYNCKPDSVTFATMIQAYKAKGMTETAQDIQSKMLEMQNRSGTKLI 181 GD++KM +LF +MKE +C PD++TFATMIQAY A GMTE AQ++++KM+ M+ SG KLI Sbjct: 277 GDVEKMGELFLTMKERHCVPDNITFATMIQAYNALGMTEAAQNLENKMIAMKENSGKKLI 336 >ref|XP_006442193.1| hypothetical protein CICLE_v10020011mg [Citrus clementina] gi|557544455|gb|ESR55433.1| hypothetical protein CICLE_v10020011mg [Citrus clementina] Length = 471 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/60 (60%), Positives = 49/60 (81%) Frame = +2 Query: 2 GDLDKMNKLFSSMKEYNCKPDSVTFATMIQAYKAKGMTETAQDIQSKMLEMQNRSGTKLI 181 GD++KM +LF +MKE +C PD++TFATMIQAY A GMTE AQ++++KM+ M+ SG KLI Sbjct: 410 GDVEKMGELFLTMKERHCVPDNITFATMIQAYNALGMTEAAQNLENKMIAMKENSGKKLI 469 >emb|CBI24939.3| unnamed protein product [Vitis vinifera] Length = 485 Score = 79.7 bits (195), Expect = 4e-13 Identities = 35/61 (57%), Positives = 49/61 (80%) Frame = +2 Query: 2 GDLDKMNKLFSSMKEYNCKPDSVTFATMIQAYKAKGMTETAQDIQSKMLEMQNRSGTKLI 181 GD+++M +LF MKE CKPD++TFATMIQAY A+GM E AQ+++ M+ +N+SGT+LI Sbjct: 424 GDVERMGELFLVMKERKCKPDNITFATMIQAYNAQGMIEAAQNLEVNMITTKNKSGTRLI 483 Query: 182 G 184 G Sbjct: 484 G 484 >ref|XP_006492786.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like [Citrus sinensis] Length = 471 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/60 (58%), Positives = 48/60 (80%) Frame = +2 Query: 2 GDLDKMNKLFSSMKEYNCKPDSVTFATMIQAYKAKGMTETAQDIQSKMLEMQNRSGTKLI 181 GD++KM +LF +MKE +C PD++TFA MIQAY A GMTE AQ++++KM+ M+ SG KLI Sbjct: 410 GDVEKMGELFLAMKERHCVPDNITFAVMIQAYHALGMTEAAQNLENKMIAMKENSGKKLI 469 >ref|XP_002273156.2| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like [Vitis vinifera] Length = 538 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/58 (55%), Positives = 46/58 (79%) Frame = +2 Query: 2 GDLDKMNKLFSSMKEYNCKPDSVTFATMIQAYKAKGMTETAQDIQSKMLEMQNRSGTK 175 GD+++M +LF MKE CKPD++TFATMIQAY A+GM E AQ+++ M+ +N+SGT+ Sbjct: 424 GDVERMGELFLVMKERKCKPDNITFATMIQAYNAQGMIEAAQNLEVNMITTKNKSGTR 481 >gb|EXB68332.1| hypothetical protein L484_004678 [Morus notabilis] Length = 488 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/56 (58%), Positives = 41/56 (73%) Frame = +2 Query: 2 GDLDKMNKLFSSMKEYNCKPDSVTFATMIQAYKAKGMTETAQDIQSKMLEMQNRSG 169 GD+ M +LFS+MKE C PDS+TFATMI AY A GM E AQD++SKM+ + SG Sbjct: 426 GDVKSMRQLFSAMKERKCYPDSITFATMIHAYNALGMMEAAQDLESKMIATDDDSG 481 >ref|XP_003544432.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like [Glycine max] Length = 481 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/61 (49%), Positives = 46/61 (75%) Frame = +2 Query: 2 GDLDKMNKLFSSMKEYNCKPDSVTFATMIQAYKAKGMTETAQDIQSKMLEMQNRSGTKLI 181 G+L KM +LF +M+E C+PD++TFA MIQ+Y +GMTE Q++++ M+ ++ GTKLI Sbjct: 420 GNLKKMGELFLAMRERKCEPDNITFACMIQSYNTQGMTEAVQNLENMMISAKSSLGTKLI 479 Query: 182 G 184 G Sbjct: 480 G 480 >ref|XP_002517779.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543051|gb|EEF44586.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 486 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/56 (57%), Positives = 41/56 (73%) Frame = +2 Query: 2 GDLDKMNKLFSSMKEYNCKPDSVTFATMIQAYKAKGMTETAQDIQSKMLEMQNRSG 169 GD+DKM +LF M+E C PD+VTFATMIQAY+ +GMTE AQ ++ ML + SG Sbjct: 424 GDVDKMAELFLEMRERECMPDNVTFATMIQAYRGQGMTEAAQALEKMMLAAKGNSG 479 >gb|EMJ20528.1| hypothetical protein PRUPE_ppa019225mg, partial [Prunus persica] Length = 473 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/49 (59%), Positives = 40/49 (81%) Frame = +2 Query: 2 GDLDKMNKLFSSMKEYNCKPDSVTFATMIQAYKAKGMTETAQDIQSKML 148 GD+ K+++LF +MKE C PD +TFATMIQAY A+GMTE A+D+Q +M+ Sbjct: 419 GDVRKVSELFLAMKEKKCLPDHITFATMIQAYNARGMTEAAEDLQKRMI 467 >gb|EXB68330.1| hypothetical protein L484_004676 [Morus notabilis] Length = 445 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/49 (61%), Positives = 37/49 (75%) Frame = +2 Query: 2 GDLDKMNKLFSSMKEYNCKPDSVTFATMIQAYKAKGMTETAQDIQSKML 148 GD+ M +LFS+MKE C PD +TFATMI AY A GM E AQD++SKM+ Sbjct: 392 GDVKSMRQLFSAMKERKCYPDGITFATMIHAYNALGMMEAAQDLESKMI 440 >gb|ESW14490.1| hypothetical protein PHAVU_008G285500g [Phaseolus vulgaris] gi|561015630|gb|ESW14491.1| hypothetical protein PHAVU_008G285500g [Phaseolus vulgaris] Length = 433 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/60 (50%), Positives = 43/60 (71%) Frame = +2 Query: 2 GDLDKMNKLFSSMKEYNCKPDSVTFATMIQAYKAKGMTETAQDIQSKMLEMQNRSGTKLI 181 GDL KM +LF +M+E C+PD++TFA+MI AY +GMTE AQ +++ M+ +N KLI Sbjct: 372 GDLKKMCELFMAMRERKCEPDNITFASMILAYNTQGMTEAAQKLENMMISAKNNLDIKLI 431 >gb|EOX96641.1| Tetratricopeptide repeat-like superfamily protein isoform 2 [Theobroma cacao] gi|508704746|gb|EOX96642.1| Tetratricopeptide repeat-like superfamily protein isoform 2 [Theobroma cacao] gi|508704747|gb|EOX96643.1| Tetratricopeptide repeat-like superfamily protein isoform 2 [Theobroma cacao] Length = 492 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/55 (50%), Positives = 38/55 (69%) Frame = +2 Query: 2 GDLDKMNKLFSSMKEYNCKPDSVTFATMIQAYKAKGMTETAQDIQSKMLEMQNRS 166 GDL KM +LF M+E C PD++TFATMIQAY GM E AQ++++K++ S Sbjct: 425 GDLKKMGELFLMMEEKKCMPDNITFATMIQAYNTHGMIEAAQNLENKLISTNKNS 479 >gb|EOX96640.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] Length = 549 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/55 (50%), Positives = 38/55 (69%) Frame = +2 Query: 2 GDLDKMNKLFSSMKEYNCKPDSVTFATMIQAYKAKGMTETAQDIQSKMLEMQNRS 166 GDL KM +LF M+E C PD++TFATMIQAY GM E AQ++++K++ S Sbjct: 458 GDLKKMGELFLMMEEKKCMPDNITFATMIQAYNTHGMIEAAQNLENKLISTNKNS 512 >ref|XP_004308684.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like [Fragaria vesca subsp. vesca] Length = 462 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/59 (50%), Positives = 42/59 (71%), Gaps = 6/59 (10%) Frame = +2 Query: 2 GDLDKMNKLFSSMKEYNCKPDSVTFATMIQAYKAKGMTETAQDIQSKML------EMQN 160 GD++KM +LF +M+E C PD +TFATMIQA KA GMT A+D++ +M+ EM+N Sbjct: 404 GDINKMGELFLTMEEKKCVPDHITFATMIQACKALGMTAAAEDLKKRMITTIDHSEMEN 462 >ref|XP_006344375.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like [Solanum tuberosum] Length = 482 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/49 (53%), Positives = 38/49 (77%) Frame = +2 Query: 2 GDLDKMNKLFSSMKEYNCKPDSVTFATMIQAYKAKGMTETAQDIQSKML 148 GD+++M LF MK CKPD +TF+TMIQAY ++GMTE A D+++K++ Sbjct: 400 GDIERMVALFLEMKVRKCKPDYITFSTMIQAYNSQGMTEAAMDLKTKII 448 >ref|XP_004244962.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like isoform 2 [Solanum lycopersicum] Length = 454 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/49 (53%), Positives = 38/49 (77%) Frame = +2 Query: 2 GDLDKMNKLFSSMKEYNCKPDSVTFATMIQAYKAKGMTETAQDIQSKML 148 GD+++M LF MK CKPD +TF+TMIQAY ++GMTE A D++++M+ Sbjct: 401 GDIERMVALFLEMKVRKCKPDYITFSTMIQAYNSQGMTEAAMDLKTEMI 449 >ref|XP_004244961.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like isoform 1 [Solanum lycopersicum] Length = 466 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/49 (53%), Positives = 38/49 (77%) Frame = +2 Query: 2 GDLDKMNKLFSSMKEYNCKPDSVTFATMIQAYKAKGMTETAQDIQSKML 148 GD+++M LF MK CKPD +TF+TMIQAY ++GMTE A D++++M+ Sbjct: 401 GDIERMVALFLEMKVRKCKPDYITFSTMIQAYNSQGMTEAAMDLKTEMI 449 >ref|XP_004135941.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like [Cucumis sativus] gi|449514880|ref|XP_004164505.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like [Cucumis sativus] Length = 477 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/49 (55%), Positives = 38/49 (77%) Frame = +2 Query: 2 GDLDKMNKLFSSMKEYNCKPDSVTFATMIQAYKAKGMTETAQDIQSKML 148 G++ KM +LF MKE C PD +TFATMI+A KA+GMTE AQ +++K++ Sbjct: 423 GNVRKMGELFLEMKENKCVPDGITFATMIRALKAQGMTEDAQRLENKLI 471 >ref|XP_003599420.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355488468|gb|AES69671.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 511 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/72 (40%), Positives = 44/72 (61%) Frame = +2 Query: 2 GDLDKMNKLFSSMKEYNCKPDSVTFATMIQAYKAKGMTETAQDIQSKMLEMQNRSGTKLI 181 GDL KM +LF +M+ C+PD TF MIQAY +G+TE A+++++ M+ ++ SG Sbjct: 428 GDLKKMGELFLAMRARKCEPDRTTFTCMIQAYNTQGITEAAKNLETMMISAKDSSGMLQF 487 Query: 182 GK*FFL*SHYVL 217 + F YVL Sbjct: 488 LQSFLWCKFYVL 499 >ref|XP_002877905.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297323743|gb|EFH54164.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 439 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/49 (46%), Positives = 35/49 (71%) Frame = +2 Query: 2 GDLDKMNKLFSSMKEYNCKPDSVTFATMIQAYKAKGMTETAQDIQSKML 148 GDL M +L+ M+E CKPD +TFATMI+ YKA G+ + Q+++ +M+ Sbjct: 379 GDLATMKELYIQMEERKCKPDKITFATMIKTYKAHGIFDAVQELEKQMI 427