BLASTX nr result
ID: Rheum21_contig00032387
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00032387 (511 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526071.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_002526071.1| conserved hypothetical protein [Ricinus communis] gi|223534568|gb|EEF36265.1| conserved hypothetical protein [Ricinus communis] Length = 505 Score = 57.4 bits (137), Expect = 2e-06 Identities = 36/100 (36%), Positives = 56/100 (56%), Gaps = 6/100 (6%) Frame = -1 Query: 511 RASSGSCHDACKYGTPHEFKAKPKRPV--RRRSMPNTEIPIEIFVPSDKRSAKAVKPSS- 341 RAS+GSCHD CK+G H F+ K +RP R R +P+ + IE +K S KPSS Sbjct: 45 RASTGSCHDFCKFGRKHAFEEKARRPFPRRNRKLPDEQNSIEFQPERNKTSKVTGKPSSN 104 Query: 340 --VAPDASVR-SSSIGAPKSIRQQAPSSTKVRSSHVSKQI 230 P+ S++ +SS ++I + +S K++ S S ++ Sbjct: 105 SETPPEVSLKQASSKVKEENISAKGANSLKMKPSPGSSRV 144