BLASTX nr result
ID: Rheum21_contig00032368
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00032368 (273 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004248491.1| PREDICTED: pentatricopeptide repeat-containi... 73 4e-11 ref|XP_006360029.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 ref|XP_006407066.1| hypothetical protein EUTSA_v10020856mg [Eutr... 72 1e-10 ref|XP_004488692.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 ref|XP_006477941.1| PREDICTED: pentatricopeptide repeat-containi... 70 4e-10 ref|XP_006442285.1| hypothetical protein CICLE_v10020422mg [Citr... 69 6e-10 gb|EOY13642.1| Pentatricopeptide repeat (PPR) superfamily protei... 69 8e-10 ref|XP_002298921.2| hypothetical protein POPTR_0001s38850g [Popu... 68 1e-09 ref|XP_002882884.1| predicted protein [Arabidopsis lyrata subsp.... 68 1e-09 ref|XP_006299283.1| hypothetical protein CARUB_v10015437mg [Caps... 67 2e-09 ref|XP_004301959.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 gb|EXC11739.1| hypothetical protein L484_020794 [Morus notabilis] 66 4e-09 ref|XP_004146072.1| PREDICTED: pentatricopeptide repeat-containi... 66 5e-09 ref|XP_006849944.1| hypothetical protein AMTR_s00022p00130870 [A... 65 7e-09 ref|NP_188076.1| pentatricopeptide repeat-containing protein [Ar... 64 2e-08 ref|XP_002267684.1| PREDICTED: pentatricopeptide repeat-containi... 63 4e-08 gb|EPS67170.1| hypothetical protein M569_07606 [Genlisea aurea] 63 5e-08 ref|XP_003581673.1| PREDICTED: pentatricopeptide repeat-containi... 63 5e-08 emb|CAN60667.1| hypothetical protein VITISV_028261 [Vitis vinifera] 63 5e-08 ref|XP_002447107.1| hypothetical protein SORBIDRAFT_06g028710 [S... 62 6e-08 >ref|XP_004248491.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14580, mitochondrial-like [Solanum lycopersicum] Length = 387 Score = 72.8 bits (177), Expect = 4e-11 Identities = 33/64 (51%), Positives = 45/64 (70%) Frame = +3 Query: 3 RRSADAKQIMGLMVSRGWKPSFDSFKMLFMALSEEGLLEDADWVLKQMVRYGFVPRMGMW 182 +R +AK M +M+ + PSF+S+K++ L + L+ D DWVLKQMVR+GFVPRMGMW Sbjct: 303 KRFLEAKNFMSVMIDKRVNPSFESYKVIVHGLCDGKLVGDLDWVLKQMVRHGFVPRMGMW 362 Query: 183 CKAL 194 K L Sbjct: 363 KKIL 366 >ref|XP_006360029.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14580, mitochondrial-like [Solanum tuberosum] Length = 387 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/64 (50%), Positives = 45/64 (70%) Frame = +3 Query: 3 RRSADAKQIMGLMVSRGWKPSFDSFKMLFMALSEEGLLEDADWVLKQMVRYGFVPRMGMW 182 +R +AK M +M+ + PSF+S+K++ L + L+ D DWVLKQM+R+GFVPRMGMW Sbjct: 303 KRYLEAKDFMAVMIDKRVNPSFESYKVIVHGLCDGKLVGDLDWVLKQMMRHGFVPRMGMW 362 Query: 183 CKAL 194 K L Sbjct: 363 RKIL 366 >ref|XP_006407066.1| hypothetical protein EUTSA_v10020856mg [Eutrema salsugineum] gi|557108212|gb|ESQ48519.1| hypothetical protein EUTSA_v10020856mg [Eutrema salsugineum] Length = 404 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/64 (48%), Positives = 46/64 (71%) Frame = +3 Query: 3 RRSADAKQIMGLMVSRGWKPSFDSFKMLFMALSEEGLLEDADWVLKQMVRYGFVPRMGMW 182 +R+ +AK++M M+S G +PSF S+K + + L E +E+ DWVL+QMV +GFVP+ GMW Sbjct: 316 KRNLEAKEMMSQMISWGMRPSFVSYKKMVLGLCETKSVEEMDWVLRQMVNHGFVPKTGMW 375 Query: 183 CKAL 194 K L Sbjct: 376 WKVL 379 >ref|XP_004488692.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14580, mitochondrial-like [Cicer arietinum] Length = 398 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/60 (50%), Positives = 46/60 (76%) Frame = +3 Query: 3 RRSADAKQIMGLMVSRGWKPSFDSFKMLFMALSEEGLLEDADWVLKQMVRYGFVPRMGMW 182 +R +AK+++ MV++G+ PS+DS+K L + +EGL+E+ +W +K MVR GFVPRMGMW Sbjct: 316 KRFCEAKEVVEKMVAKGFVPSYDSYKGLILGYCKEGLVEEVEWGVKGMVRMGFVPRMGMW 375 >ref|XP_006477941.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14580, mitochondrial-like [Citrus sinensis] Length = 404 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/60 (51%), Positives = 42/60 (70%) Frame = +3 Query: 3 RRSADAKQIMGLMVSRGWKPSFDSFKMLFMALSEEGLLEDADWVLKQMVRYGFVPRMGMW 182 +R +AK+++G M+ PSF S+K L L + L+ED DWVLK+MV+ GFVPRMGMW Sbjct: 317 KRFPEAKELVGRMICERMSPSFVSYKKLIHGLCNQKLVEDVDWVLKKMVQQGFVPRMGMW 376 >ref|XP_006442285.1| hypothetical protein CICLE_v10020422mg [Citrus clementina] gi|557544547|gb|ESR55525.1| hypothetical protein CICLE_v10020422mg [Citrus clementina] Length = 404 Score = 68.9 bits (167), Expect = 6e-10 Identities = 31/60 (51%), Positives = 41/60 (68%) Frame = +3 Query: 3 RRSADAKQIMGLMVSRGWKPSFDSFKMLFMALSEEGLLEDADWVLKQMVRYGFVPRMGMW 182 +R +AK+++G M+ PSF S+K L L + L+ED DWVLK MV+ GFVPRMGMW Sbjct: 317 KRFPEAKELVGRMICERMSPSFVSYKKLIHGLCNQKLVEDVDWVLKTMVQQGFVPRMGMW 376 >gb|EOY13642.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] Length = 408 Score = 68.6 bits (166), Expect = 8e-10 Identities = 30/64 (46%), Positives = 43/64 (67%) Frame = +3 Query: 6 RSADAKQIMGLMVSRGWKPSFDSFKMLFMALSEEGLLEDADWVLKQMVRYGFVPRMGMWC 185 R +AK++MG M+ PSFDS+K L +E L+ + DW LKQMV+ GFVP+MGMW Sbjct: 325 RFMEAKELMGRMILERVSPSFDSYKKLIHGFCKEKLVREVDWALKQMVQQGFVPKMGMWT 384 Query: 186 KALE 197 + ++ Sbjct: 385 QMVK 388 >ref|XP_002298921.2| hypothetical protein POPTR_0001s38850g [Populus trichocarpa] gi|550349209|gb|EEE83726.2| hypothetical protein POPTR_0001s38850g [Populus trichocarpa] Length = 292 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/63 (49%), Positives = 42/63 (66%) Frame = +3 Query: 15 DAKQIMGLMVSRGWKPSFDSFKMLFMALSEEGLLEDADWVLKQMVRYGFVPRMGMWCKAL 194 + K+ M M+ +G PSF S+K L L +E LL D DWVLKQM R GFVP+MGMW + + Sbjct: 209 EGKEFMVRMIGQGVDPSFVSYKKLVHGLCKERLLRDLDWVLKQMARQGFVPKMGMWVQMV 268 Query: 195 EKM 203 + + Sbjct: 269 QSV 271 >ref|XP_002882884.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297328724|gb|EFH59143.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 409 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/64 (45%), Positives = 46/64 (71%) Frame = +3 Query: 3 RRSADAKQIMGLMVSRGWKPSFDSFKMLFMALSEEGLLEDADWVLKQMVRYGFVPRMGMW 182 +R+ +AK++M M+S G +PSF S+K + + L E + + DWVL++MV +GFVP+ GMW Sbjct: 321 KRNLEAKEMMSQMISWGMRPSFLSYKKMVLGLCETKSVAEMDWVLRKMVNHGFVPKTGMW 380 Query: 183 CKAL 194 KA+ Sbjct: 381 WKAV 384 >ref|XP_006299283.1| hypothetical protein CARUB_v10015437mg [Capsella rubella] gi|482567992|gb|EOA32181.1| hypothetical protein CARUB_v10015437mg [Capsella rubella] Length = 408 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/62 (46%), Positives = 44/62 (70%) Frame = +3 Query: 3 RRSADAKQIMGLMVSRGWKPSFDSFKMLFMALSEEGLLEDADWVLKQMVRYGFVPRMGMW 182 +R+ +AK++M M+S G +PSF S+K + + L E + + DWVL+QMV +GFVP+ GMW Sbjct: 321 KRNLEAKEMMSQMISWGMRPSFLSYKKMVLGLCETKSVAELDWVLRQMVNHGFVPKTGMW 380 Query: 183 CK 188 K Sbjct: 381 WK 382 >ref|XP_004301959.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14580, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 399 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/60 (51%), Positives = 41/60 (68%) Frame = +3 Query: 3 RRSADAKQIMGLMVSRGWKPSFDSFKMLFMALSEEGLLEDADWVLKQMVRYGFVPRMGMW 182 +R +AK+ M MVS+ PSF S+K L L +E +E+ DWVL+QM R GFVP+MGMW Sbjct: 311 QRFVEAKEFMIRMVSKRVGPSFVSYKQLIQGLCKENKVEELDWVLRQMTRQGFVPKMGMW 370 >gb|EXC11739.1| hypothetical protein L484_020794 [Morus notabilis] Length = 405 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/66 (45%), Positives = 42/66 (63%) Frame = +3 Query: 6 RSADAKQIMGLMVSRGWKPSFDSFKMLFMALSEEGLLEDADWVLKQMVRYGFVPRMGMWC 185 R ++A ++M ++S G PS SFK L L EE +ED DW LKQM + GFVP+M MW Sbjct: 321 RFSEANEVMSRIISMGSSPSIKSFKCLIHGLCEENRMEDIDWALKQMGKQGFVPKMWMWK 380 Query: 186 KALEKM 203 + L+ + Sbjct: 381 EILQSL 386 >ref|XP_004146072.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14580, mitochondrial-like [Cucumis sativus] gi|449503658|ref|XP_004162112.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14580, mitochondrial-like [Cucumis sativus] Length = 411 Score = 65.9 bits (159), Expect = 5e-09 Identities = 30/56 (53%), Positives = 38/56 (67%) Frame = +3 Query: 15 DAKQIMGLMVSRGWKPSFDSFKMLFMALSEEGLLEDADWVLKQMVRYGFVPRMGMW 182 +A+ M M+S G PSF S+K L L ++ L ED DWVLKQMV GFVP++GMW Sbjct: 321 EARDCMHRMISEGMDPSFVSYKKLLSGLCKKKLTEDVDWVLKQMVMQGFVPKVGMW 376 >ref|XP_006849944.1| hypothetical protein AMTR_s00022p00130870 [Amborella trichopoda] gi|548853542|gb|ERN11525.1| hypothetical protein AMTR_s00022p00130870 [Amborella trichopoda] Length = 404 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/63 (49%), Positives = 42/63 (66%) Frame = +3 Query: 15 DAKQIMGLMVSRGWKPSFDSFKMLFMALSEEGLLEDADWVLKQMVRYGFVPRMGMWCKAL 194 +A +++ LMVS+G PSF S+KML L + LL D D VL QM+ GF+PRMG W + L Sbjct: 328 EANKLLSLMVSKGIFPSFLSYKMLIDGLCDMDLLRDVDAVLTQMINQGFIPRMGTWMRIL 387 Query: 195 EKM 203 E + Sbjct: 388 ESL 390 >ref|NP_188076.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75274210|sp|Q9LUD6.1|PP230_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g14580, mitochondrial; Flags: Precursor gi|9294380|dbj|BAB02390.1| unnamed protein product [Arabidopsis thaliana] gi|119935972|gb|ABM06049.1| At3g14580 [Arabidopsis thaliana] gi|332642020|gb|AEE75541.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 405 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/65 (43%), Positives = 45/65 (69%) Frame = +3 Query: 3 RRSADAKQIMGLMVSRGWKPSFDSFKMLFMALSEEGLLEDADWVLKQMVRYGFVPRMGMW 182 +R+ +AK++M M+S G +PSF S+K + + L E + + DWVL+QMV +GFVP+ MW Sbjct: 321 KRNLEAKEMMSQMISWGMRPSFLSYKKMVLGLCETKSVVEMDWVLRQMVNHGFVPKTLMW 380 Query: 183 CKALE 197 K ++ Sbjct: 381 WKVVQ 385 >ref|XP_002267684.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14580, mitochondrial-like [Vitis vinifera] Length = 393 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/66 (45%), Positives = 39/66 (59%) Frame = +3 Query: 6 RSADAKQIMGLMVSRGWKPSFDSFKMLFMALSEEGLLEDADWVLKQMVRYGFVPRMGMWC 185 R AK+ M M+ G PSF S+KM+ L +E L+ D W+LKQMV GFVP MW Sbjct: 312 RFGKAKEFMCQMIDEGVSPSFVSYKMMIYGLCKENLVADVVWILKQMVEQGFVPERWMWR 371 Query: 186 KALEKM 203 + L+ M Sbjct: 372 RILQTM 377 >gb|EPS67170.1| hypothetical protein M569_07606 [Genlisea aurea] Length = 393 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/60 (46%), Positives = 39/60 (65%) Frame = +3 Query: 3 RRSADAKQIMGLMVSRGWKPSFDSFKMLFMALSEEGLLEDADWVLKQMVRYGFVPRMGMW 182 +R +AKQ+MG M+ +G PSF+S+K++ E ++D W L QMV GFV RMGMW Sbjct: 311 KRYEEAKQLMGKMMGKGINPSFESYKLIIRGFCCENAVDDVVWGLNQMVSSGFVARMGMW 370 >ref|XP_003581673.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14580, mitochondrial-like [Brachypodium distachyon] Length = 392 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/69 (43%), Positives = 40/69 (57%) Frame = +3 Query: 3 RRSADAKQIMGLMVSRGWKPSFDSFKMLFMALSEEGLLEDADWVLKQMVRYGFVPRMGMW 182 R +AK ++ +M + G +PSF S+K+L L LED + KQMV GF+PRMG W Sbjct: 296 RNFTEAKDLVCMMSAEGLRPSFSSYKLLIDGLCSVNCLEDGHLIFKQMVDQGFIPRMGTW 355 Query: 183 CKALEKMPL 209 K L M L Sbjct: 356 TKLLTSMSL 364 >emb|CAN60667.1| hypothetical protein VITISV_028261 [Vitis vinifera] Length = 393 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/66 (45%), Positives = 39/66 (59%) Frame = +3 Query: 6 RSADAKQIMGLMVSRGWKPSFDSFKMLFMALSEEGLLEDADWVLKQMVRYGFVPRMGMWC 185 R AK+ M M+ G PSF S+KM+ L +E L+ D W+LKQMV GFVP MW Sbjct: 312 RFGKAKEFMCQMIDEGVSPSFVSYKMVIYGLCKENLVADVVWILKQMVEQGFVPERWMWR 371 Query: 186 KALEKM 203 + L+ M Sbjct: 372 RILQTM 377 >ref|XP_002447107.1| hypothetical protein SORBIDRAFT_06g028710 [Sorghum bicolor] gi|241938290|gb|EES11435.1| hypothetical protein SORBIDRAFT_06g028710 [Sorghum bicolor] Length = 363 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/60 (50%), Positives = 39/60 (65%) Frame = +3 Query: 15 DAKQIMGLMVSRGWKPSFDSFKMLFMALSEEGLLEDADWVLKQMVRYGFVPRMGMWCKAL 194 +AK ++ M + G +PSF S+K+L L E ++DA VLKQMV GFVPRMG W K L Sbjct: 300 EAKSLVSTMSTEGVRPSFQSYKLLIDGLCSEDCVDDAHLVLKQMVGQGFVPRMGTWTKLL 359