BLASTX nr result
ID: Rheum21_contig00032177
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00032177 (481 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002325342.1| DC1 domain-containing family protein [Populu... 56 6e-06 >ref|XP_002325342.1| DC1 domain-containing family protein [Populus trichocarpa] gi|222862217|gb|EEE99723.1| DC1 domain-containing family protein [Populus trichocarpa] Length = 838 Score = 55.8 bits (133), Expect = 6e-06 Identities = 39/128 (30%), Positives = 60/128 (46%), Gaps = 8/128 (6%) Frame = +3 Query: 120 TEGICIGDSHSITNYTEELGLENEEAKYCTVCEQHITGAAYTCTACSLALHKECVESSSP 299 TE GD H + ++ + +E K CT C+ ++G AY C C LH+ C + S Sbjct: 143 TEIPYFGDEHLLVSFNAKQEVE----KTCTGCQLLLSGPAYGCLDCEFYLHESCKDMPSE 198 Query: 300 LQLP-------RVTWDKLGSDCDSCKVHKRRGVPFDCPTCEFKRQ-LKRRAYDGVPSVVR 455 +Q P R + GS+CD+C + R+ V + C C+F L V S ++ Sbjct: 199 IQHPYHPPHPLRAQVAEYGSECDACHMPIRK-VFYRCSECDFNLHILCANKSLQVASSLK 257 Query: 456 HECDEHLL 479 H+ EH L Sbjct: 258 HKGHEHNL 265