BLASTX nr result
ID: Rheum21_contig00032144
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00032144 (309 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526423.1| mads box protein, putative [Ricinus communis... 58 1e-06 >ref|XP_002526423.1| mads box protein, putative [Ricinus communis] gi|223534285|gb|EEF35999.1| mads box protein, putative [Ricinus communis] Length = 205 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/45 (60%), Positives = 32/45 (71%) Frame = +1 Query: 1 KEGVLSAANKLLQEKIEEQNGIFGIDPMANNFEYPLTIHNQIFQY 135 KEG+L AAN+ LQ+KIEE I PM NF YPLTI N+IFQ+ Sbjct: 161 KEGILKAANQYLQDKIEENVDITNFAPMTTNFPYPLTIQNEIFQF 205