BLASTX nr result
ID: Rheum21_contig00032067
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00032067 (216 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY17295.1| Phosphoinositide phosphatase family protein isofo... 56 6e-06 gb|EOY17293.1| Phosphoinositide phosphatase family protein isofo... 56 6e-06 >gb|EOY17295.1| Phosphoinositide phosphatase family protein isoform 3 [Theobroma cacao] Length = 751 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = -1 Query: 132 MANTNSIPKSASLPSAKIHPYNDPEIDPCSYVLEKFMLYETRQR 1 MA + ++ + SLP AKIHP DPE DP SY LEKF LYETR R Sbjct: 1 MAKSENLNSNLSLPYAKIHPSMDPEADPNSYSLEKFRLYETRAR 44 >gb|EOY17293.1| Phosphoinositide phosphatase family protein isoform 1 [Theobroma cacao] gi|508725397|gb|EOY17294.1| Phosphoinositide phosphatase family protein isoform 1 [Theobroma cacao] Length = 911 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = -1 Query: 132 MANTNSIPKSASLPSAKIHPYNDPEIDPCSYVLEKFMLYETRQR 1 MA + ++ + SLP AKIHP DPE DP SY LEKF LYETR R Sbjct: 1 MAKSENLNSNLSLPYAKIHPSMDPEADPNSYSLEKFRLYETRAR 44