BLASTX nr result
ID: Rheum21_contig00031894
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00031894 (515 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004232626.1| PREDICTED: pentatricopeptide repeat-containi... 112 4e-23 gb|EMJ12567.1| hypothetical protein PRUPE_ppa002507mg [Prunus pe... 110 1e-22 ref|XP_006363176.1| PREDICTED: pentatricopeptide repeat-containi... 108 6e-22 ref|XP_004295517.1| PREDICTED: pentatricopeptide repeat-containi... 108 7e-22 ref|XP_002304600.2| hypothetical protein POPTR_0003s15360g [Popu... 107 2e-21 ref|XP_002297917.1| hypothetical protein POPTR_0001s12190g [Popu... 106 3e-21 ref|XP_002275605.1| PREDICTED: pentatricopeptide repeat-containi... 103 2e-20 ref|XP_006468575.1| PREDICTED: pentatricopeptide repeat-containi... 100 2e-19 ref|XP_006448599.1| hypothetical protein CICLE_v10014519mg [Citr... 100 3e-19 emb|CBI27232.3| unnamed protein product [Vitis vinifera] 99 4e-19 gb|ESW10855.1| hypothetical protein PHAVU_009G243700g [Phaseolus... 99 8e-19 ref|XP_002528143.1| pentatricopeptide repeat-containing protein,... 97 2e-18 ref|XP_002867892.1| EMB1025 [Arabidopsis lyrata subsp. lyrata] g... 97 3e-18 ref|XP_003534864.1| PREDICTED: pentatricopeptide repeat-containi... 94 1e-17 ref|XP_006283284.1| hypothetical protein CARUB_v10004320mg [Caps... 92 7e-17 ref|NP_193742.1| pentatricopeptide repeat-containing protein [Ar... 92 9e-17 ref|XP_006404148.1| hypothetical protein EUTSA_v10010168mg [Eutr... 91 1e-16 gb|EXB83265.1| hypothetical protein L484_011559 [Morus notabilis] 84 2e-14 ref|XP_006855880.1| hypothetical protein AMTR_s00037p00138240 [A... 81 1e-13 gb|EOX96827.1| Pentatricopeptide repeat (PPR) superfamily protei... 81 1e-13 >ref|XP_004232626.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like [Solanum lycopersicum] Length = 717 Score = 112 bits (281), Expect = 4e-23 Identities = 59/84 (70%), Positives = 66/84 (78%) Frame = +1 Query: 259 ETDPEPLISDEFFKLGPKLGSYKHGDSTFYTLIEKCADCCDFGSIEKIFGRMKREKRVFR 438 ET+ E ISD+ FK PKLGS+K GDSTFY+LIEK A+ DF S+EK+FGRMK EKRVF Sbjct: 113 ETEVEVPISDKLFKEAPKLGSFKLGDSTFYSLIEKYANSEDFTSLEKVFGRMKCEKRVFI 172 Query: 439 EKSFIFVFRAYGKAHLPELAAGLF 510 EKSFI VFRAYGKA LPE A LF Sbjct: 173 EKSFILVFRAYGKARLPEKAVELF 196 >gb|EMJ12567.1| hypothetical protein PRUPE_ppa002507mg [Prunus persica] Length = 664 Score = 110 bits (276), Expect = 1e-22 Identities = 56/94 (59%), Positives = 69/94 (73%) Frame = +1 Query: 229 NKACESEDEIETDPEPLISDEFFKLGPKLGSYKHGDSTFYTLIEKCADCCDFGSIEKIFG 408 N+A ++E + EP IS+E FK G KLGSYK GDSTFY+LIE A+ DF S+E++ Sbjct: 50 NQALQTEPVNNDETEPPISNEIFKKGTKLGSYKSGDSTFYSLIENYANLGDFRSLEQVLD 109 Query: 409 RMKREKRVFREKSFIFVFRAYGKAHLPELAAGLF 510 RMKRE+RVF E+SFI +FRAYGKAHLP A LF Sbjct: 110 RMKRERRVFIEQSFILMFRAYGKAHLPNKAVELF 143 >ref|XP_006363176.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like isoform X1 [Solanum tuberosum] gi|565395083|ref|XP_006363177.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like isoform X2 [Solanum tuberosum] Length = 717 Score = 108 bits (271), Expect = 6e-22 Identities = 57/84 (67%), Positives = 65/84 (77%) Frame = +1 Query: 259 ETDPEPLISDEFFKLGPKLGSYKHGDSTFYTLIEKCADCCDFGSIEKIFGRMKREKRVFR 438 +T+ E ISD+ FK PKLGS+K GDSTFY+LIEK A+ DF S+EK+F RMK EKRVF Sbjct: 113 KTEVEVPISDKLFKEAPKLGSFKLGDSTFYSLIEKYANSGDFTSLEKVFDRMKCEKRVFI 172 Query: 439 EKSFIFVFRAYGKAHLPELAAGLF 510 EKSFI VFRAYGKA LPE A LF Sbjct: 173 EKSFILVFRAYGKARLPEKAVELF 196 >ref|XP_004295517.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like [Fragaria vesca subsp. vesca] Length = 647 Score = 108 bits (270), Expect = 7e-22 Identities = 52/82 (63%), Positives = 62/82 (75%) Frame = +1 Query: 265 DPEPLISDEFFKLGPKLGSYKHGDSTFYTLIEKCADCCDFGSIEKIFGRMKREKRVFREK 444 +P+P IS+E F+ GP G+YK GDSTFY+LIE A DFGS+EK+ RMKRE+RVF E Sbjct: 43 EPDPPISEEIFRKGPNFGAYKSGDSTFYSLIENYASLGDFGSLEKVLDRMKRERRVFVEG 102 Query: 445 SFIFVFRAYGKAHLPELAAGLF 510 SFI VFRA+GKAHLP A LF Sbjct: 103 SFIAVFRAFGKAHLPNQAVDLF 124 >ref|XP_002304600.2| hypothetical protein POPTR_0003s15360g [Populus trichocarpa] gi|550343237|gb|EEE79579.2| hypothetical protein POPTR_0003s15360g [Populus trichocarpa] Length = 672 Score = 107 bits (267), Expect = 2e-21 Identities = 55/92 (59%), Positives = 67/92 (72%) Frame = +1 Query: 235 ACESEDEIETDPEPLISDEFFKLGPKLGSYKHGDSTFYTLIEKCADCCDFGSIEKIFGRM 414 A + E IE DP ISD+ FK GPK+GSYK GDSTFY+LI+ A+ DF S+EK+ RM Sbjct: 60 ASDREHGIEHDPP--ISDKIFKSGPKMGSYKLGDSTFYSLIDNYANLGDFKSLEKVLDRM 117 Query: 415 KREKRVFREKSFIFVFRAYGKAHLPELAAGLF 510 + EKRV EK F+ +F+AYGKAHLPE A GLF Sbjct: 118 RCEKRVVVEKCFVVIFKAYGKAHLPEKAVGLF 149 >ref|XP_002297917.1| hypothetical protein POPTR_0001s12190g [Populus trichocarpa] gi|222845175|gb|EEE82722.1| hypothetical protein POPTR_0001s12190g [Populus trichocarpa] Length = 670 Score = 106 bits (265), Expect = 3e-21 Identities = 52/89 (58%), Positives = 65/89 (73%) Frame = +1 Query: 244 SEDEIETDPEPLISDEFFKLGPKLGSYKHGDSTFYTLIEKCADCCDFGSIEKIFGRMKRE 423 ++ E +P+P ISD+ FK GPK+GSY+ GDSTFY+LI A+ DF S+EK+ RMK E Sbjct: 60 TDQENGIEPDPPISDKIFKSGPKMGSYRLGDSTFYSLINNYANLGDFKSLEKVLDRMKCE 119 Query: 424 KRVFREKSFIFVFRAYGKAHLPELAAGLF 510 KRV EK FI +F+AYGKAHLPE A LF Sbjct: 120 KRVIFEKCFIVIFKAYGKAHLPEKAVDLF 148 >ref|XP_002275605.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like [Vitis vinifera] Length = 644 Score = 103 bits (257), Expect = 2e-20 Identities = 50/78 (64%), Positives = 61/78 (78%) Frame = +1 Query: 280 ISDEFFKLGPKLGSYKHGDSTFYTLIEKCADCCDFGSIEKIFGRMKREKRVFREKSFIFV 459 I D+ FK ++GSYK GDSTFY+LIE A+ DFG++ ++F RMKRE+RVF EK+FI V Sbjct: 46 IPDQIFKSASQMGSYKSGDSTFYSLIENYANSGDFGTLFQVFDRMKRERRVFIEKNFILV 105 Query: 460 FRAYGKAHLPELAAGLFG 513 FRAYGKAHLPE A LFG Sbjct: 106 FRAYGKAHLPEKAIELFG 123 >ref|XP_006468575.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like [Citrus sinensis] Length = 664 Score = 100 bits (250), Expect = 2e-19 Identities = 53/94 (56%), Positives = 64/94 (68%) Frame = +1 Query: 229 NKACESEDEIETDPEPLISDEFFKLGPKLGSYKHGDSTFYTLIEKCADCCDFGSIEKIFG 408 NK E+E + E SDE F PKLGSY+ GDSTFY+LI+ A+ DF S+E + Sbjct: 48 NKQMETEPQGNAKSEQPFSDEIFNSTPKLGSYQLGDSTFYSLIQHYANSGDFKSLEMVLY 107 Query: 409 RMKREKRVFREKSFIFVFRAYGKAHLPELAAGLF 510 RM+REKRV EKSFIF+F+AYGKAHL E A LF Sbjct: 108 RMRREKRVVLEKSFIFIFKAYGKAHLVEEAIRLF 141 >ref|XP_006448599.1| hypothetical protein CICLE_v10014519mg [Citrus clementina] gi|557551210|gb|ESR61839.1| hypothetical protein CICLE_v10014519mg [Citrus clementina] Length = 664 Score = 100 bits (248), Expect = 3e-19 Identities = 53/94 (56%), Positives = 64/94 (68%) Frame = +1 Query: 229 NKACESEDEIETDPEPLISDEFFKLGPKLGSYKHGDSTFYTLIEKCADCCDFGSIEKIFG 408 NK E+E + E SDE F PKLGSY+ GDSTFY+LI+ A+ DF S+E + Sbjct: 48 NKHMETEPQGNAKSEQPFSDEVFNSTPKLGSYQLGDSTFYSLIQHYANSGDFKSLEMVLC 107 Query: 409 RMKREKRVFREKSFIFVFRAYGKAHLPELAAGLF 510 RM+REKRV EKSFIF+F+AYGKAHL E A LF Sbjct: 108 RMRREKRVALEKSFIFIFKAYGKAHLVEEAVRLF 141 >emb|CBI27232.3| unnamed protein product [Vitis vinifera] Length = 660 Score = 99.4 bits (246), Expect = 4e-19 Identities = 48/73 (65%), Positives = 58/73 (79%) Frame = +1 Query: 295 FKLGPKLGSYKHGDSTFYTLIEKCADCCDFGSIEKIFGRMKREKRVFREKSFIFVFRAYG 474 FK ++GSYK GDSTFY+LIE A+ DFG++ ++F RMKRE+RVF EK+FI VFRAYG Sbjct: 67 FKSASQMGSYKSGDSTFYSLIENYANSGDFGTLFQVFDRMKRERRVFIEKNFILVFRAYG 126 Query: 475 KAHLPELAAGLFG 513 KAHLPE A LFG Sbjct: 127 KAHLPEKAIELFG 139 >gb|ESW10855.1| hypothetical protein PHAVU_009G243700g [Phaseolus vulgaris] Length = 645 Score = 98.6 bits (244), Expect = 8e-19 Identities = 47/81 (58%), Positives = 61/81 (75%) Frame = +1 Query: 268 PEPLISDEFFKLGPKLGSYKHGDSTFYTLIEKCADCCDFGSIEKIFGRMKREKRVFREKS 447 P+P S E FK G K+GSYK GD +FY+LI+ A DFGS+E++ +MKRE+RVF E++ Sbjct: 42 PQPHPSAEIFKSGTKMGSYKLGDLSFYSLIQNHASTLDFGSLEEVLQQMKRERRVFVERN 101 Query: 448 FIFVFRAYGKAHLPELAAGLF 510 FI +F+AYGKAHLPE A LF Sbjct: 102 FIVMFKAYGKAHLPEKAVDLF 122 >ref|XP_002528143.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223532441|gb|EEF34234.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 653 Score = 97.4 bits (241), Expect = 2e-18 Identities = 51/94 (54%), Positives = 62/94 (65%) Frame = +1 Query: 229 NKACESEDEIETDPEPLISDEFFKLGPKLGSYKHGDSTFYTLIEKCADCCDFGSIEKIFG 408 N E+ E E+ P ISD+ F PK+GS+K GDSTFY+LIE A DF S+EK+ Sbjct: 40 NNDLENGSEPESSP---ISDKIFSSPPKMGSFKVGDSTFYSLIENYAYSSDFNSLEKVLN 96 Query: 409 RMKREKRVFREKSFIFVFRAYGKAHLPELAAGLF 510 RM+ E RVF EKSF +F+AYGKAHLP A LF Sbjct: 97 RMRLENRVFSEKSFFVMFKAYGKAHLPNKAIELF 130 >ref|XP_002867892.1| EMB1025 [Arabidopsis lyrata subsp. lyrata] gi|297313728|gb|EFH44151.1| EMB1025 [Arabidopsis lyrata subsp. lyrata] Length = 658 Score = 96.7 bits (239), Expect = 3e-18 Identities = 48/86 (55%), Positives = 61/86 (70%) Frame = +1 Query: 253 EIETDPEPLISDEFFKLGPKLGSYKHGDSTFYTLIEKCADCCDFGSIEKIFGRMKREKRV 432 E+ET E IS++ FK PK+GS+K GDST ++IE A+ DF S+EK+ R++ E RV Sbjct: 50 EVETPLEAPISEQMFKSAPKMGSFKLGDSTLSSMIENYANLGDFASVEKLLSRIRLENRV 109 Query: 433 FREKSFIFVFRAYGKAHLPELAAGLF 510 E+SFI VFRAYGKAHLPE A LF Sbjct: 110 IIERSFIVVFRAYGKAHLPEKAVDLF 135 >ref|XP_003534864.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like isoform X1 [Glycine max] gi|571476386|ref|XP_006586943.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like isoform X2 [Glycine max] gi|571476388|ref|XP_006586944.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like isoform X3 [Glycine max] gi|571476390|ref|XP_006586945.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like isoform X4 [Glycine max] gi|571476393|ref|XP_006586946.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like isoform X5 [Glycine max] gi|571476395|ref|XP_006586947.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like isoform X6 [Glycine max] Length = 642 Score = 94.4 bits (233), Expect = 1e-17 Identities = 46/80 (57%), Positives = 59/80 (73%) Frame = +1 Query: 271 EPLISDEFFKLGPKLGSYKHGDSTFYTLIEKCADCCDFGSIEKIFGRMKREKRVFREKSF 450 +P S E FK G ++GSYK GD +FY+LIE A DF S+E++ +MKRE+RVF EK+F Sbjct: 40 KPHPSSEIFKSGTQMGSYKLGDLSFYSLIESHASSLDFRSLEEVLHQMKRERRVFLEKNF 99 Query: 451 IFVFRAYGKAHLPELAAGLF 510 I +F+AYGKAHLPE A LF Sbjct: 100 IVMFKAYGKAHLPEKAVDLF 119 >ref|XP_006283284.1| hypothetical protein CARUB_v10004320mg [Capsella rubella] gi|482551989|gb|EOA16182.1| hypothetical protein CARUB_v10004320mg [Capsella rubella] Length = 660 Score = 92.0 bits (227), Expect = 7e-17 Identities = 46/86 (53%), Positives = 57/86 (66%) Frame = +1 Query: 253 EIETDPEPLISDEFFKLGPKLGSYKHGDSTFYTLIEKCADCCDFGSIEKIFGRMKREKRV 432 E+E E IS+ FK PK+GSYK GDST ++IE A+ DF S+E++ R++ E RV Sbjct: 50 EVENPSEAPISENMFKSAPKMGSYKLGDSTLSSMIENYANSGDFASVEQVLSRVRLENRV 109 Query: 433 FREKSFIFVFRAYGKAHLPELAAGLF 510 E SFI VFRAYGKAHLP A LF Sbjct: 110 ISEHSFIVVFRAYGKAHLPGKAVDLF 135 >ref|NP_193742.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75098720|sp|O49436.1|PP327_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g20090; AltName: Full=Protein EMBRYO DEFECTIVE 1025 gi|2827663|emb|CAA16617.1| membrane-associated salt-inducible-like protein [Arabidopsis thaliana] gi|7268804|emb|CAB79009.1| membrane-associated salt-inducible-like protein [Arabidopsis thaliana] gi|58013024|gb|AAW62965.1| embryo-defective 1025 [Arabidopsis thaliana] gi|332658871|gb|AEE84271.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 660 Score = 91.7 bits (226), Expect = 9e-17 Identities = 46/89 (51%), Positives = 61/89 (68%) Frame = +1 Query: 244 SEDEIETDPEPLISDEFFKLGPKLGSYKHGDSTFYTLIEKCADCCDFGSIEKIFGRMKRE 423 S + +E E IS++ FK PK+GS+K GDST ++IE A+ DF S+EK+ R++ E Sbjct: 47 SMEVVENPLEAPISEKMFKSAPKMGSFKLGDSTLSSMIESYANSGDFDSVEKLLSRIRLE 106 Query: 424 KRVFREKSFIFVFRAYGKAHLPELAAGLF 510 RV E+SFI VFRAYGKAHLP+ A LF Sbjct: 107 NRVIIERSFIVVFRAYGKAHLPDKAVDLF 135 >ref|XP_006404148.1| hypothetical protein EUTSA_v10010168mg [Eutrema salsugineum] gi|557105267|gb|ESQ45601.1| hypothetical protein EUTSA_v10010168mg [Eutrema salsugineum] Length = 696 Score = 91.3 bits (225), Expect = 1e-16 Identities = 46/97 (47%), Positives = 64/97 (65%), Gaps = 1/97 (1%) Frame = +1 Query: 223 TPNKACESEDEIETDPEPL-ISDEFFKLGPKLGSYKHGDSTFYTLIEKCADCCDFGSIEK 399 +P + E+E + +P IS++ F+ PK+GSYK GDST ++IE A+ DF S+EK Sbjct: 77 SPKPSMETEQQHTENPSAAPISEKMFESAPKMGSYKLGDSTLSSMIENYANSGDFASVEK 136 Query: 400 IFGRMKREKRVFREKSFIFVFRAYGKAHLPELAAGLF 510 + R++ E R+ RE SFI +FRAYGKAHLPE LF Sbjct: 137 LLSRIRLENRMIREHSFIVLFRAYGKAHLPEKTIELF 173 >gb|EXB83265.1| hypothetical protein L484_011559 [Morus notabilis] Length = 699 Score = 84.0 bits (206), Expect = 2e-14 Identities = 41/68 (60%), Positives = 47/68 (69%) Frame = +1 Query: 307 PKLGSYKHGDSTFYTLIEKCADCCDFGSIEKIFGRMKREKRVFREKSFIFVFRAYGKAHL 486 P GSYK GDSTFY+LI A DF S+EK+ R+K E+RV EK FI +FRAYGKAHL Sbjct: 58 PDSGSYKLGDSTFYSLIHNYASSADFRSLEKVLDRIKSERRVLVEKCFIVIFRAYGKAHL 117 Query: 487 PELAAGLF 510 P A LF Sbjct: 118 PNKAVDLF 125 >ref|XP_006855880.1| hypothetical protein AMTR_s00037p00138240 [Amborella trichopoda] gi|548859701|gb|ERN17347.1| hypothetical protein AMTR_s00037p00138240 [Amborella trichopoda] Length = 649 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/84 (46%), Positives = 56/84 (66%) Frame = +1 Query: 259 ETDPEPLISDEFFKLGPKLGSYKHGDSTFYTLIEKCADCCDFGSIEKIFGRMKREKRVFR 438 E + EP +++E F+ P +G YK GDSTF++L++ AD DF + ++F RMKRE RVF Sbjct: 47 EDEEEPPVAEEIFRGAPTMGPYKQGDSTFFSLVQTYADSGDFVLLNQVFTRMKRENRVFT 106 Query: 439 EKSFIFVFRAYGKAHLPELAAGLF 510 EK FI V +A+G+A E A +F Sbjct: 107 EKLFILVIKAHGRAGSYESAIKVF 130 >gb|EOX96827.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 636 Score = 81.3 bits (199), Expect = 1e-13 Identities = 41/81 (50%), Positives = 53/81 (65%) Frame = +1 Query: 268 PEPLISDEFFKLGPKLGSYKHGDSTFYTLIEKCADCCDFGSIEKIFGRMKREKRVFREKS 447 P PL SD+ F P+ GS++ GDST Y+LI A DF S+ + RMK + RVF EK Sbjct: 34 PTPL-SDQLFNSAPQSGSFRLGDSTCYSLIHHYAHKVDFASLHDVLCRMKLQNRVFIEKY 92 Query: 448 FIFVFRAYGKAHLPELAAGLF 510 F+ +F+AYG+AHLPE A LF Sbjct: 93 FLLIFKAYGRAHLPEKAVDLF 113