BLASTX nr result
ID: Rheum21_contig00031558
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00031558 (485 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_624333.1| replicase polyprotein [Citrus leaf blotch virus... 49 2e-06 gb|ACH73184.1| replicase polyprotein [Dweet mottle virus] 49 2e-06 gb|ACF94740.1| putative replicase polyprotein [Citrus leaf blotc... 49 2e-06 gb|ACF94738.1| putative replicase polyprotein [Citrus leaf blotc... 49 2e-06 >ref|NP_624333.1| replicase polyprotein [Citrus leaf blotch virus] gi|81964041|sp|Q91QZ3.1|RDRP_CLBVS RecName: Full=RNA replication protein; Includes: RecName: Full=RNA-directed RNA polymerase; Includes: RecName: Full=Helicase gi|14270249|emb|CAC39422.1| hypothetical protein [Citrus leaf blotch virus] Length = 1962 Score = 48.5 bits (114), Expect(2) = 2e-06 Identities = 22/41 (53%), Positives = 25/41 (60%) Frame = +3 Query: 90 HFHPFSRTPENHILCDVSPGVVNADSFISCPIKEKKVQCIK 212 H HP S+ ENH+L DV PGVVN + C IKE KV K Sbjct: 71 HSHPLSKIFENHLLFDVLPGVVNTSRLVMCSIKESKVLVFK 111 Score = 28.5 bits (62), Expect(2) = 2e-06 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +1 Query: 1 NSLFAHSLEPFLKKNLTGLGIELFQNG 81 N FA+SL + KK + +GIEL+ NG Sbjct: 41 NKHFAYSLNSYQKKIASKVGIELYPNG 67 >gb|ACH73184.1| replicase polyprotein [Dweet mottle virus] Length = 1962 Score = 48.5 bits (114), Expect(2) = 2e-06 Identities = 22/41 (53%), Positives = 25/41 (60%) Frame = +3 Query: 90 HFHPFSRTPENHILCDVSPGVVNADSFISCPIKEKKVQCIK 212 H HP S+ ENH+L DV PGVVN + C IKE KV K Sbjct: 71 HSHPLSKIFENHLLFDVLPGVVNTSRLVMCSIKESKVLVFK 111 Score = 28.5 bits (62), Expect(2) = 2e-06 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +1 Query: 1 NSLFAHSLEPFLKKNLTGLGIELFQNG 81 N FA+SL + KK + +GIEL+ NG Sbjct: 41 NKHFAYSLNSYQKKIASKVGIELYPNG 67 >gb|ACF94740.1| putative replicase polyprotein [Citrus leaf blotch virus] Length = 1962 Score = 48.5 bits (114), Expect(2) = 2e-06 Identities = 22/41 (53%), Positives = 25/41 (60%) Frame = +3 Query: 90 HFHPFSRTPENHILCDVSPGVVNADSFISCPIKEKKVQCIK 212 H HP S+ ENH+L DV PGVVN + C IKE KV K Sbjct: 71 HSHPLSKIFENHLLFDVLPGVVNTSRLVMCSIKESKVLVFK 111 Score = 28.5 bits (62), Expect(2) = 2e-06 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +1 Query: 1 NSLFAHSLEPFLKKNLTGLGIELFQNG 81 N FA+SL + KK + +GIEL+ NG Sbjct: 41 NKHFAYSLNSYQKKIASKVGIELYPNG 67 >gb|ACF94738.1| putative replicase polyprotein [Citrus leaf blotch virus] Length = 1962 Score = 48.5 bits (114), Expect(2) = 2e-06 Identities = 22/41 (53%), Positives = 25/41 (60%) Frame = +3 Query: 90 HFHPFSRTPENHILCDVSPGVVNADSFISCPIKEKKVQCIK 212 H HP S+ ENH+L DV PGVVN + C IKE KV K Sbjct: 71 HSHPLSKIFENHLLFDVLPGVVNTSRLVMCSIKESKVLVFK 111 Score = 28.5 bits (62), Expect(2) = 2e-06 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +1 Query: 1 NSLFAHSLEPFLKKNLTGLGIELFQNG 81 N FA+SL + KK + +GIEL+ NG Sbjct: 41 NKHFAYSLNSYQKKIASKVGIELYPNG 67