BLASTX nr result
ID: Rheum21_contig00030951
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00030951 (521 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006306080.1| hypothetical protein CARUB_v10011488mg [Caps... 57 3e-06 >ref|XP_006306080.1| hypothetical protein CARUB_v10011488mg [Capsella rubella] gi|482574791|gb|EOA38978.1| hypothetical protein CARUB_v10011488mg [Capsella rubella] Length = 556 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/45 (48%), Positives = 33/45 (73%) Frame = +1 Query: 346 IMHYVLLNEIVTKKTKELWFLVRGNITRFSIKEFAAITGLNCNAY 480 ++H VL ++T K E+WF+ G++ RFS++EFA +TGLNCN Y Sbjct: 234 LVHQVLCRSLITDKRHEMWFVYGGHLIRFSLREFAILTGLNCNPY 278