BLASTX nr result
ID: Rheum21_contig00030666
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00030666 (289 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY16465.1| BTB/POZ domain-containing protein [Theobroma cacao] 57 2e-06 >gb|EOY16465.1| BTB/POZ domain-containing protein [Theobroma cacao] Length = 298 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/38 (76%), Positives = 31/38 (81%), Gaps = 4/38 (10%) Frame = +1 Query: 49 LKAKVAFLRFWSPLDHQHRGS----PAFFDVVLVAADE 150 LKAKVAFLRFWSPLDH HRGS P F DVVLVA+D+ Sbjct: 89 LKAKVAFLRFWSPLDHAHRGSTSPGPFFPDVVLVASDD 126