BLASTX nr result
ID: Rheum21_contig00030073
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00030073 (259 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279343.1| PREDICTED: pentatricopeptide repeat-containi... 59 9e-07 ref|XP_004300978.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 >ref|XP_002279343.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Vitis vinifera] Length = 623 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/51 (54%), Positives = 35/51 (68%) Frame = +2 Query: 107 KPLHILLEEKFISLLQSCKKHKLLCQIQTQLFIYGLQDSRFVVPKLIARCA 259 KP H LLEE+FISLLQSCK K + QIQ Q+ G Q + ++ PKL+ CA Sbjct: 31 KPPHRLLEERFISLLQSCKTSKQVHQIQAQIIANGFQYNEYITPKLVTICA 81 >ref|XP_004300978.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 590 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/47 (57%), Positives = 34/47 (72%) Frame = +2 Query: 119 ILLEEKFISLLQSCKKHKLLCQIQTQLFIYGLQDSRFVVPKLIARCA 259 +LLEEKFISLLQSCK K L QIQ Q+ ++G + +V PKL+ CA Sbjct: 2 MLLEEKFISLLQSCKTIKELHQIQAQVTLHGFSQNDYVAPKLVTACA 48