BLASTX nr result
ID: Rheum21_contig00029917
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00029917 (265 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002311132.1| hypothetical protein POPTR_0008s04800g [Popu... 56 4e-06 >ref|XP_002311132.1| hypothetical protein POPTR_0008s04800g [Populus trichocarpa] gi|222850952|gb|EEE88499.1| hypothetical protein POPTR_0008s04800g [Populus trichocarpa] Length = 706 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/67 (43%), Positives = 44/67 (65%), Gaps = 2/67 (2%) Frame = +3 Query: 15 PSVEDLHKPFEQQGDSRSQLLEEAVAQVRIYSKLQELLAQNKTLKSGVSPEAHARK--VC 188 PS+ED K +++ + + L+EA+AQ+RI S+L+ LL + KTL G SPE HA+K V Sbjct: 254 PSIEDQEKVSDEKAKATIKALKEALAQIRICSRLEGLLLKKKTLSLGDSPEIHAQKVDVA 313 Query: 189 YCDISDL 209 C + D+ Sbjct: 314 MCQVFDM 320