BLASTX nr result
ID: Rheum21_contig00029830
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00029830 (522 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006348865.1| PREDICTED: F-box protein At3g07870-like isof... 56 4e-06 ref|XP_006348862.1| PREDICTED: F-box protein At3g07870-like isof... 56 4e-06 gb|EMT07664.1| hypothetical protein F775_21978 [Aegilops tauschii] 55 1e-05 >ref|XP_006348865.1| PREDICTED: F-box protein At3g07870-like isoform X4 [Solanum tuberosum] Length = 397 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = -1 Query: 162 MSDYILEDTLLLIFKYLPVESLLRFRSVCKEWKQLLDSPSLVQDHLS 22 MSDY+ E+ LL IF LPV+S+LR RSVCK W LL SPS HL+ Sbjct: 1 MSDYLPEELLLDIFTKLPVKSILRCRSVCKSWYSLLTSPSFTFTHLN 47 >ref|XP_006348862.1| PREDICTED: F-box protein At3g07870-like isoform X1 [Solanum tuberosum] gi|565364298|ref|XP_006348863.1| PREDICTED: F-box protein At3g07870-like isoform X2 [Solanum tuberosum] gi|565364300|ref|XP_006348864.1| PREDICTED: F-box protein At3g07870-like isoform X3 [Solanum tuberosum] Length = 464 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = -1 Query: 162 MSDYILEDTLLLIFKYLPVESLLRFRSVCKEWKQLLDSPSLVQDHLS 22 MSDY+ E+ LL IF LPV+S+LR RSVCK W LL SPS HL+ Sbjct: 1 MSDYLPEELLLDIFTKLPVKSILRCRSVCKSWYSLLTSPSFTFTHLN 47 >gb|EMT07664.1| hypothetical protein F775_21978 [Aegilops tauschii] Length = 199 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/47 (51%), Positives = 34/47 (72%) Frame = -1 Query: 153 YILEDTLLLIFKYLPVESLLRFRSVCKEWKQLLDSPSLVQDHLSVQT 13 Y+ ++ + I LPVESLLRFRSVCK W+ ++D S ++DHL +QT Sbjct: 14 YLPDELVSEILPRLPVESLLRFRSVCKTWRDIIDDDSFLRDHLRLQT 60