BLASTX nr result
ID: Rheum21_contig00029610
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00029610 (816 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002317252.2| hypothetical protein POPTR_0011s04040g [Popu... 62 3e-07 >ref|XP_002317252.2| hypothetical protein POPTR_0011s04040g [Populus trichocarpa] gi|550327546|gb|EEE97864.2| hypothetical protein POPTR_0011s04040g [Populus trichocarpa] Length = 818 Score = 61.6 bits (148), Expect = 3e-07 Identities = 28/54 (51%), Positives = 35/54 (64%) Frame = +2 Query: 443 YGELKVRDKLCLLCFSAFPCDVGKVGKSGVLVQKNLVIKKKILIFWWVGEGFID 604 Y L +RDKLCLLCFS FP +N V+KK++L++WWVGEGFID Sbjct: 330 YSSLDLRDKLCLLCFSVFP--------------ENSVVKKRLLMYWWVGEGFID 369