BLASTX nr result
ID: Rheum21_contig00029172
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00029172 (287 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003889748.1| hypothetical protein PGTG_21594 [Puccinia gr... 55 7e-06 >ref|XP_003889748.1| hypothetical protein PGTG_21594 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] gi|375167572|gb|EHS63463.1| hypothetical protein PGTG_21594 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 576 Score = 55.5 bits (132), Expect = 7e-06 Identities = 30/89 (33%), Positives = 43/89 (48%), Gaps = 1/89 (1%) Frame = -2 Query: 274 PFIREVRHVVGDGHCGYRSLCLLLGEDEGDYRRIRFNLASHLVDNRALYEPMLARLNPGK 95 P++ ++ +V GDGHCG+R+ LG+ EG Y IR + L D R Y R +P Sbjct: 399 PYVDQIINVKGDGHCGFRAAAYCLGKGEGQYMDIRTQVVKDLQDRRLYYN----RQDPTL 454 Query: 94 SFEQYAVEVNYFF-SPCGPRFWCDMPMVG 11 E+ +N PC W MP +G Sbjct: 455 DVEETINIINVKDPGPCAEYHWMSMPSMG 483