BLASTX nr result
ID: Rheum21_contig00029057
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00029057 (583 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533586.1| conserved hypothetical protein [Ricinus comm... 58 2e-06 >ref|XP_002533586.1| conserved hypothetical protein [Ricinus communis] gi|223526530|gb|EEF28791.1| conserved hypothetical protein [Ricinus communis] Length = 176 Score = 57.8 bits (138), Expect = 2e-06 Identities = 34/82 (41%), Positives = 45/82 (54%) Frame = -2 Query: 378 DGFTTPTSSPNRIPKMRPCPHAPKKPTVRPKVGPKRRDLPAGVRSXXXXXXXXXXXLTNE 199 DG TPTS ++IP + PCP AP+KP P +R PA R L+NE Sbjct: 96 DGCKTPTSLNHKIPTLLPCPPAPRKPKSLPS---NKRKSPARRR--------VLLDLSNE 144 Query: 198 VEAVFPPVLRTGLTFKVKKARR 133 +E++FPP LR L K+KK R+ Sbjct: 145 IESLFPPALRADLGAKIKKVRQ 166