BLASTX nr result
ID: Rheum21_contig00028299
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00028299 (286 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006482616.1| PREDICTED: uncharacterized protein LOC102617... 64 3e-08 ref|XP_006482615.1| PREDICTED: uncharacterized protein LOC102617... 64 3e-08 ref|XP_006482614.1| PREDICTED: uncharacterized protein LOC102617... 64 3e-08 ref|XP_006482612.1| PREDICTED: uncharacterized protein LOC102617... 64 3e-08 ref|XP_006431173.1| hypothetical protein CICLE_v10012474mg [Citr... 64 3e-08 ref|XP_006431172.1| hypothetical protein CICLE_v10012474mg [Citr... 64 3e-08 ref|XP_002281967.1| PREDICTED: probable lipoate-protein ligase A... 64 3e-08 emb|CAN79982.1| hypothetical protein VITISV_038033 [Vitis vinifera] 63 3e-08 gb|EOY21888.1| Biotin/lipoate A/B protein ligase family [Theobro... 63 5e-08 gb|EXB54333.1| hypothetical protein L484_006493 [Morus notabilis] 62 1e-07 ref|XP_004307170.1| PREDICTED: uncharacterized protein LOC101301... 62 1e-07 ref|XP_006373326.1| hypothetical protein POPTR_0017s12130g [Popu... 60 3e-07 ref|XP_002323867.1| hypothetical protein POPTR_0017s12130g [Popu... 60 3e-07 gb|ESW11519.1| hypothetical protein PHAVU_008G037200g [Phaseolus... 60 4e-07 gb|EMJ10668.1| hypothetical protein PRUPE_ppa009955mg [Prunus pe... 60 4e-07 ref|XP_004491819.1| PREDICTED: putative lipoate-protein ligase A... 59 5e-07 ref|XP_004241831.1| PREDICTED: uncharacterized protein LOC101252... 59 5e-07 ref|XP_004137412.1| PREDICTED: putative lipoate-protein ligase A... 59 5e-07 ref|XP_006405603.1| hypothetical protein EUTSA_v10027886mg [Eutr... 59 7e-07 ref|XP_006850833.1| hypothetical protein AMTR_s00025p00130480 [A... 58 1e-06 >ref|XP_006482616.1| PREDICTED: uncharacterized protein LOC102617401 isoform X5 [Citrus sinensis] Length = 190 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +2 Query: 182 ADVPLKRTYYVFGNHKFGGNAQSITKNRWIHHTSF 286 AD L+ YVFGN KFGGNAQSITKNRWIHHTSF Sbjct: 133 ADFQLRENDYVFGNRKFGGNAQSITKNRWIHHTSF 167 >ref|XP_006482615.1| PREDICTED: uncharacterized protein LOC102617401 isoform X4 [Citrus sinensis] Length = 209 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +2 Query: 182 ADVPLKRTYYVFGNHKFGGNAQSITKNRWIHHTSF 286 AD L+ YVFGN KFGGNAQSITKNRWIHHTSF Sbjct: 75 ADFQLRENDYVFGNRKFGGNAQSITKNRWIHHTSF 109 >ref|XP_006482614.1| PREDICTED: uncharacterized protein LOC102617401 isoform X3 [Citrus sinensis] Length = 211 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +2 Query: 182 ADVPLKRTYYVFGNHKFGGNAQSITKNRWIHHTSF 286 AD L+ YVFGN KFGGNAQSITKNRWIHHTSF Sbjct: 77 ADFQLRENDYVFGNRKFGGNAQSITKNRWIHHTSF 111 >ref|XP_006482612.1| PREDICTED: uncharacterized protein LOC102617401 isoform X1 [Citrus sinensis] gi|568858139|ref|XP_006482613.1| PREDICTED: uncharacterized protein LOC102617401 isoform X2 [Citrus sinensis] Length = 267 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +2 Query: 182 ADVPLKRTYYVFGNHKFGGNAQSITKNRWIHHTSF 286 AD L+ YVFGN KFGGNAQSITKNRWIHHTSF Sbjct: 133 ADFQLRENDYVFGNRKFGGNAQSITKNRWIHHTSF 167 >ref|XP_006431173.1| hypothetical protein CICLE_v10012474mg [Citrus clementina] gi|557533230|gb|ESR44413.1| hypothetical protein CICLE_v10012474mg [Citrus clementina] Length = 267 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +2 Query: 182 ADVPLKRTYYVFGNHKFGGNAQSITKNRWIHHTSF 286 AD L+ YVFGN KFGGNAQSITKNRWIHHTSF Sbjct: 133 ADFQLRENDYVFGNRKFGGNAQSITKNRWIHHTSF 167 >ref|XP_006431172.1| hypothetical protein CICLE_v10012474mg [Citrus clementina] gi|567877169|ref|XP_006431174.1| hypothetical protein CICLE_v10012474mg [Citrus clementina] gi|557533229|gb|ESR44412.1| hypothetical protein CICLE_v10012474mg [Citrus clementina] gi|557533231|gb|ESR44414.1| hypothetical protein CICLE_v10012474mg [Citrus clementina] Length = 209 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +2 Query: 182 ADVPLKRTYYVFGNHKFGGNAQSITKNRWIHHTSF 286 AD L+ YVFGN KFGGNAQSITKNRWIHHTSF Sbjct: 75 ADFQLRENDYVFGNRKFGGNAQSITKNRWIHHTSF 109 >ref|XP_002281967.1| PREDICTED: probable lipoate-protein ligase A [Vitis vinifera] gi|297733965|emb|CBI15212.3| unnamed protein product [Vitis vinifera] Length = 268 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +2 Query: 185 DVPLKRTYYVFGNHKFGGNAQSITKNRWIHHTSF 286 D L+ Y FGNHKFGGNAQSITKNRWIHHTSF Sbjct: 133 DFSLRENDYAFGNHKFGGNAQSITKNRWIHHTSF 166 >emb|CAN79982.1| hypothetical protein VITISV_038033 [Vitis vinifera] Length = 296 Score = 63.2 bits (152), Expect = 3e-08 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +2 Query: 185 DVPLKRTYYVFGNHKFGGNAQSITKNRWIHHTSF 286 D L+ Y FGNHKFGGNAQSITKNRWIHHTSF Sbjct: 161 DFSLRENDYXFGNHKFGGNAQSITKNRWIHHTSF 194 >gb|EOY21888.1| Biotin/lipoate A/B protein ligase family [Theobroma cacao] Length = 259 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +2 Query: 185 DVPLKRTYYVFGNHKFGGNAQSITKNRWIHHTSF 286 D L+ YVFGNHKFGGNAQSITK+RWIHHTSF Sbjct: 133 DFHLRENDYVFGNHKFGGNAQSITKSRWIHHTSF 166 >gb|EXB54333.1| hypothetical protein L484_006493 [Morus notabilis] Length = 262 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +2 Query: 185 DVPLKRTYYVFGNHKFGGNAQSITKNRWIHHTSF 286 D L+ YVFGN KFGGNAQSITKNRWIHHTSF Sbjct: 130 DFHLRENDYVFGNRKFGGNAQSITKNRWIHHTSF 163 >ref|XP_004307170.1| PREDICTED: uncharacterized protein LOC101301137 [Fragaria vesca subsp. vesca] Length = 266 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +2 Query: 185 DVPLKRTYYVFGNHKFGGNAQSITKNRWIHHTSF 286 D L+ YVFGN KFGGNAQSITKNRWIHHTSF Sbjct: 133 DFHLRENDYVFGNRKFGGNAQSITKNRWIHHTSF 166 >ref|XP_006373326.1| hypothetical protein POPTR_0017s12130g [Populus trichocarpa] gi|550320097|gb|ERP51123.1| hypothetical protein POPTR_0017s12130g [Populus trichocarpa] Length = 216 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +2 Query: 185 DVPLKRTYYVFGNHKFGGNAQSITKNRWIHHTSF 286 D L+ YVFG+ KFGGNAQSITKNRWIHHTSF Sbjct: 83 DFQLRENDYVFGDRKFGGNAQSITKNRWIHHTSF 116 >ref|XP_002323867.1| hypothetical protein POPTR_0017s12130g [Populus trichocarpa] gi|222866869|gb|EEF04000.1| hypothetical protein POPTR_0017s12130g [Populus trichocarpa] Length = 267 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +2 Query: 185 DVPLKRTYYVFGNHKFGGNAQSITKNRWIHHTSF 286 D L+ YVFG+ KFGGNAQSITKNRWIHHTSF Sbjct: 134 DFQLRENDYVFGDRKFGGNAQSITKNRWIHHTSF 167 >gb|ESW11519.1| hypothetical protein PHAVU_008G037200g [Phaseolus vulgaris] Length = 260 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +2 Query: 185 DVPLKRTYYVFGNHKFGGNAQSITKNRWIHHTSF 286 D L+ YVFG+ KFGGNAQSITKNRWIHHTSF Sbjct: 134 DFRLRENDYVFGDRKFGGNAQSITKNRWIHHTSF 167 >gb|EMJ10668.1| hypothetical protein PRUPE_ppa009955mg [Prunus persica] Length = 270 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = +2 Query: 185 DVPLKRTYYVFGNHKFGGNAQSITKNRWIHHTSF 286 D L+ YVFGN KFGGNAQSITK RWIHHTSF Sbjct: 133 DFQLRENDYVFGNRKFGGNAQSITKTRWIHHTSF 166 >ref|XP_004491819.1| PREDICTED: putative lipoate-protein ligase A-like isoform X1 [Cicer arietinum] gi|502101119|ref|XP_004491820.1| PREDICTED: putative lipoate-protein ligase A-like isoform X2 [Cicer arietinum] Length = 260 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +2 Query: 182 ADVPLKRTYYVFGNHKFGGNAQSITKNRWIHHTSF 286 AD L+ YVFG+ KFGGNAQSITK+RWIHHTSF Sbjct: 133 ADFHLRENDYVFGDRKFGGNAQSITKHRWIHHTSF 167 >ref|XP_004241831.1| PREDICTED: uncharacterized protein LOC101252893 [Solanum lycopersicum] Length = 263 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = +2 Query: 185 DVPLKRTYYVFGNHKFGGNAQSITKNRWIHHTSF 286 D L+ YVFGN KFGGNAQSITK RW+HHTSF Sbjct: 129 DFSLRENDYVFGNRKFGGNAQSITKGRWVHHTSF 162 >ref|XP_004137412.1| PREDICTED: putative lipoate-protein ligase A-like [Cucumis sativus] gi|449518213|ref|XP_004166137.1| PREDICTED: putative lipoate-protein ligase A-like [Cucumis sativus] Length = 271 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +2 Query: 185 DVPLKRTYYVFGNHKFGGNAQSITKNRWIHHTSF 286 D L+ YVFGN KFGGNAQSITK+RWIHHTSF Sbjct: 132 DFYLRENDYVFGNRKFGGNAQSITKSRWIHHTSF 165 >ref|XP_006405603.1| hypothetical protein EUTSA_v10027886mg [Eutrema salsugineum] gi|557106741|gb|ESQ47056.1| hypothetical protein EUTSA_v10027886mg [Eutrema salsugineum] Length = 267 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +2 Query: 185 DVPLKRTYYVFGNHKFGGNAQSITKNRWIHHTSF 286 D L+ YVFG+ KFGGNAQSIT+NRWIHHTSF Sbjct: 133 DFQLRENDYVFGDRKFGGNAQSITRNRWIHHTSF 166 >ref|XP_006850833.1| hypothetical protein AMTR_s00025p00130480 [Amborella trichopoda] gi|548854504|gb|ERN12414.1| hypothetical protein AMTR_s00025p00130480 [Amborella trichopoda] Length = 207 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = +2 Query: 185 DVPLKRTYYVFGNHKFGGNAQSITKNRWIHHTSF 286 D L+ Y FGN KFGGNAQSITK RWIHHTSF Sbjct: 80 DFQLRENDYAFGNRKFGGNAQSITKGRWIHHTSF 113