BLASTX nr result
ID: Rheum21_contig00028248
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00028248 (287 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002321989.1| hypothetical protein POPTR_0015s01350g [Popu... 60 4e-07 ref|XP_006401750.1| hypothetical protein EUTSA_v10012933mg [Eutr... 58 1e-06 ref|XP_002317787.2| hypothetical protein POPTR_0012s02430g [Popu... 58 1e-06 ref|XP_004502677.1| PREDICTED: KH domain-containing protein At4g... 58 1e-06 ref|XP_002864215.1| hypothetical protein ARALYDRAFT_495374 [Arab... 58 1e-06 ref|NP_200118.3| RNA-binding KH domain-containing protein [Arabi... 58 1e-06 ref|XP_004146230.1| PREDICTED: KH domain-containing protein At4g... 58 1e-06 gb|ESW08501.1| hypothetical protein PHAVU_009G051000g [Phaseolus... 57 3e-06 gb|EOY23588.1| RNA-binding KH domain-containing protein [Theobro... 57 3e-06 gb|EMJ20144.1| hypothetical protein PRUPE_ppa002491mg [Prunus pe... 57 3e-06 ref|XP_003523354.1| PREDICTED: KH domain-containing protein At4g... 57 3e-06 ref|XP_003602281.1| Poly(rC)-binding protein [Medicago truncatul... 56 4e-06 >ref|XP_002321989.1| hypothetical protein POPTR_0015s01350g [Populus trichocarpa] gi|222868985|gb|EEF06116.1| hypothetical protein POPTR_0015s01350g [Populus trichocarpa] Length = 685 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = +3 Query: 3 EKVIRMSGTPDQAERAQSLLQGFLLSIQEDGP 98 EK+I++SGTP+QAERAQSLLQGF+LSIQEDGP Sbjct: 654 EKIIQISGTPEQAERAQSLLQGFILSIQEDGP 685 >ref|XP_006401750.1| hypothetical protein EUTSA_v10012933mg [Eutrema salsugineum] gi|557102840|gb|ESQ43203.1| hypothetical protein EUTSA_v10012933mg [Eutrema salsugineum] Length = 647 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +3 Query: 3 EKVIRMSGTPDQAERAQSLLQGFLLSIQEDGP 98 + +IR+SGTP+QAERAQSLLQGF+LSIQEDGP Sbjct: 616 QNIIRISGTPEQAERAQSLLQGFILSIQEDGP 647 >ref|XP_002317787.2| hypothetical protein POPTR_0012s02430g [Populus trichocarpa] gi|550326217|gb|EEE96007.2| hypothetical protein POPTR_0012s02430g [Populus trichocarpa] Length = 655 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +3 Query: 3 EKVIRMSGTPDQAERAQSLLQGFLLSIQEDGP 98 EK+I++SGTP+QAERAQSLLQGF+LS QEDGP Sbjct: 624 EKIIKISGTPEQAERAQSLLQGFILSTQEDGP 655 >ref|XP_004502677.1| PREDICTED: KH domain-containing protein At4g18375-like isoform X2 [Cicer arietinum] Length = 648 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +3 Query: 3 EKVIRMSGTPDQAERAQSLLQGFLLSIQEDGP 98 EK+I++SGTP+QAERAQSLLQGF+LS QEDGP Sbjct: 617 EKIIQLSGTPEQAERAQSLLQGFILSTQEDGP 648 >ref|XP_002864215.1| hypothetical protein ARALYDRAFT_495374 [Arabidopsis lyrata subsp. lyrata] gi|297310050|gb|EFH40474.1| hypothetical protein ARALYDRAFT_495374 [Arabidopsis lyrata subsp. lyrata] Length = 652 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +3 Query: 3 EKVIRMSGTPDQAERAQSLLQGFLLSIQEDGP 98 + +IR+SGTP+QAERAQSLLQGF+LSIQEDGP Sbjct: 621 QNIIRISGTPEQAERAQSLLQGFILSIQEDGP 652 >ref|NP_200118.3| RNA-binding KH domain-containing protein [Arabidopsis thaliana] gi|17065220|gb|AAL32764.1| RNA-binding protein-like [Arabidopsis thaliana] gi|30725478|gb|AAP37761.1| At5g53060 [Arabidopsis thaliana] gi|332008915|gb|AED96298.1| RNA-binding KH domain-containing protein [Arabidopsis thaliana] Length = 652 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +3 Query: 3 EKVIRMSGTPDQAERAQSLLQGFLLSIQEDGP 98 + +IR+SGTP+QAERAQSLLQGF+LSIQEDGP Sbjct: 621 QNIIRISGTPEQAERAQSLLQGFILSIQEDGP 652 >ref|XP_004146230.1| PREDICTED: KH domain-containing protein At4g18375-like [Cucumis sativus] gi|449517605|ref|XP_004165836.1| PREDICTED: KH domain-containing protein At4g18375-like [Cucumis sativus] Length = 666 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/32 (78%), Positives = 32/32 (100%) Frame = +3 Query: 3 EKVIRMSGTPDQAERAQSLLQGFLLSIQEDGP 98 +K+I++SGTP+QAERAQSLLQGF+LS+QEDGP Sbjct: 635 QKIIQISGTPEQAERAQSLLQGFILSLQEDGP 666 >gb|ESW08501.1| hypothetical protein PHAVU_009G051000g [Phaseolus vulgaris] Length = 644 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +3 Query: 3 EKVIRMSGTPDQAERAQSLLQGFLLSIQEDGP 98 +K+I++SGTP+QAERAQSLLQGF+LS QEDGP Sbjct: 613 QKIIQISGTPEQAERAQSLLQGFILSTQEDGP 644 >gb|EOY23588.1| RNA-binding KH domain-containing protein [Theobroma cacao] Length = 675 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +3 Query: 3 EKVIRMSGTPDQAERAQSLLQGFLLSIQEDGP 98 +K+I++SGTP+QAERAQSLLQGF+LS QEDGP Sbjct: 644 QKIIQISGTPEQAERAQSLLQGFILSTQEDGP 675 >gb|EMJ20144.1| hypothetical protein PRUPE_ppa002491mg [Prunus persica] Length = 667 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +3 Query: 3 EKVIRMSGTPDQAERAQSLLQGFLLSIQEDGP 98 +K+I++SGTP+QAERAQSLLQGF+LS QEDGP Sbjct: 636 QKIIQISGTPEQAERAQSLLQGFILSTQEDGP 667 >ref|XP_003523354.1| PREDICTED: KH domain-containing protein At4g18375-like [Glycine max] Length = 644 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +3 Query: 3 EKVIRMSGTPDQAERAQSLLQGFLLSIQEDGP 98 +K+I++SGTP+QAERAQSLLQGF+LS QEDGP Sbjct: 613 QKIIQISGTPEQAERAQSLLQGFILSTQEDGP 644 >ref|XP_003602281.1| Poly(rC)-binding protein [Medicago truncatula] gi|355491329|gb|AES72532.1| Poly(rC)-binding protein [Medicago truncatula] Length = 646 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 3 EKVIRMSGTPDQAERAQSLLQGFLLSIQEDGP 98 EK+I++SGTP+QAER QSLLQGF+LS QEDGP Sbjct: 615 EKIIQISGTPEQAERGQSLLQGFILSTQEDGP 646