BLASTX nr result
ID: Rheum21_contig00027840
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00027840 (255 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003605622.1| hypothetical protein MTR_4g035030 [Medicago ... 54 8e-08 ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago ... 52 2e-07 >ref|XP_003605622.1| hypothetical protein MTR_4g035030 [Medicago truncatula] gi|357471517|ref|XP_003606043.1| hypothetical protein MTR_4g051230 [Medicago truncatula] gi|358349395|ref|XP_003638723.1| hypothetical protein MTR_141s0027 [Medicago truncatula] gi|355504658|gb|AES85861.1| hypothetical protein MTR_141s0027 [Medicago truncatula] gi|355506677|gb|AES87819.1| hypothetical protein MTR_4g035030 [Medicago truncatula] gi|355507098|gb|AES88240.1| hypothetical protein MTR_4g051230 [Medicago truncatula] Length = 95 Score = 53.9 bits (128), Expect(2) = 8e-08 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +3 Query: 99 MAKSVDATDLISLSLSMETY*VRTFKFRETLE*K 200 MAK VDATDLI LSL METY V+TFKFRETLE K Sbjct: 1 MAKLVDATDLIGLSLGMETYQVKTFKFRETLELK 34 Score = 28.1 bits (61), Expect(2) = 8e-08 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 Query: 200 KMGNPEPTPSLKKE 241 KMGNPEP PS +K+ Sbjct: 34 KMGNPEPNPSFRKQ 47 >ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago truncatula] gi|355516767|gb|AES98390.1| hypothetical protein MTR_5g067940 [Medicago truncatula] Length = 69 Score = 52.4 bits (124), Expect(2) = 2e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 99 MAKSVDATDLISLSLSMETY*VRTFKFRETLE*K 200 MA+ VDATDLI LSL METY V+TFKFRETLE K Sbjct: 1 MAELVDATDLIGLSLGMETYQVKTFKFRETLELK 34 Score = 28.1 bits (61), Expect(2) = 2e-07 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 Query: 200 KMGNPEPTPSLKKE 241 KMGNPEP PS +K+ Sbjct: 34 KMGNPEPNPSFRKQ 47