BLASTX nr result
ID: Rheum21_contig00027627
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00027627 (394 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFU25705.1| gag-pol precursor [Castanea mollissima] 59 9e-07 ref|XP_006486503.1| PREDICTED: uncharacterized protein LOC102607... 57 2e-06 ref|XP_006478539.1| PREDICTED: uncharacterized protein LOC102614... 57 3e-06 ref|WP_008481407.1| hypothetical protein [Nitrolancetus hollandi... 56 4e-06 >gb|AFU25705.1| gag-pol precursor [Castanea mollissima] Length = 1106 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/42 (54%), Positives = 31/42 (73%) Frame = -3 Query: 392 GPNWEGPYRVVASPGNGSYKLEELSGRSVPRTWNTLNLKKFY 267 G NWEGPYR+ + G G+Y+LE+L GR V R WN NL+++Y Sbjct: 1064 GTNWEGPYRITSVAGIGAYRLEDLDGRVVHRPWNVNNLRRYY 1105 >ref|XP_006486503.1| PREDICTED: uncharacterized protein LOC102607673 [Citrus sinensis] Length = 1866 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/42 (54%), Positives = 30/42 (71%) Frame = -3 Query: 392 GPNWEGPYRVVASPGNGSYKLEELSGRSVPRTWNTLNLKKFY 267 GP WEGPYRV+ + G G+YKL GR V R+WN +LKK++ Sbjct: 1824 GPKWEGPYRVIRATGPGAYKLAYQDGRDVKRSWNAEHLKKYF 1865 >ref|XP_006478539.1| PREDICTED: uncharacterized protein LOC102614166 [Citrus sinensis] Length = 1089 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/42 (54%), Positives = 30/42 (71%) Frame = -3 Query: 392 GPNWEGPYRVVASPGNGSYKLEELSGRSVPRTWNTLNLKKFY 267 GP WEGPYRV+ + G G+YKL GR V R+WN +LKK++ Sbjct: 1047 GPKWEGPYRVIRATGPGAYKLACQDGRDVKRSWNAEHLKKYF 1088 >ref|WP_008481407.1| hypothetical protein [Nitrolancetus hollandicus] gi|390170603|emb|CCF85985.1| hypothetical protein NITHO_6470001 [Nitrolancetus hollandicus Lb] Length = 60 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/42 (59%), Positives = 28/42 (66%) Frame = -3 Query: 392 GPNWEGPYRVVASPGNGSYKLEELSGRSVPRTWNTLNLKKFY 267 G NWEGPY V NG YKL++L R V R WN +NLKKFY Sbjct: 18 GINWEGPYIVTEVVRNGVYKLKDLEDRPVKRPWNVINLKKFY 59