BLASTX nr result
ID: Rheum21_contig00027508
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00027508 (1084 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301522.1| hypothetical protein POPTR_0002s19420g [Popu... 59 3e-06 ref|XP_002320968.1| hypothetical protein POPTR_0014s11360g [Popu... 59 4e-06 >ref|XP_002301522.1| hypothetical protein POPTR_0002s19420g [Populus trichocarpa] gi|222843248|gb|EEE80795.1| hypothetical protein POPTR_0002s19420g [Populus trichocarpa] Length = 138 Score = 58.9 bits (141), Expect = 3e-06 Identities = 29/68 (42%), Positives = 44/68 (64%) Frame = -2 Query: 870 R*REGRSSSAMKSERVVMTRKPQLRRQSQSQDLGFKTKVQTLKGLIPNPGSKGLEGLFRD 691 R + GR + + + R++M R+ + + G + +V+TLK LIPN S GL+GLFR+ Sbjct: 50 RQKNGRHARSKRPGRILMKRRARAEGSTVRSGYGIERRVRTLKKLIPNSESMGLDGLFRE 109 Query: 690 TADYILAL 667 TADYIL+L Sbjct: 110 TADYILSL 117 >ref|XP_002320968.1| hypothetical protein POPTR_0014s11360g [Populus trichocarpa] gi|222861741|gb|EEE99283.1| hypothetical protein POPTR_0014s11360g [Populus trichocarpa] Length = 135 Score = 58.5 bits (140), Expect = 4e-06 Identities = 31/74 (41%), Positives = 46/74 (62%) Frame = -2 Query: 888 PPRNC*R*REGRSSSAMKSERVVMTRKPQLRRQSQSQDLGFKTKVQTLKGLIPNPGSKGL 709 PPR + + GR + + R++M R ++ ++ G +V+TLK LIPN S GL Sbjct: 46 PPR---KHKHGRHAEGKRPRRILMKRMARVEGSTRRAGYGVGRRVRTLKKLIPNGESLGL 102 Query: 708 EGLFRDTADYILAL 667 +GLFR+TADYIL+L Sbjct: 103 DGLFRETADYILSL 116