BLASTX nr result
ID: Rheum21_contig00026810
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00026810 (258 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006472756.1| PREDICTED: WAT1-related protein At1g21890-li... 57 2e-06 ref|XP_006434165.1| hypothetical protein CICLE_v10001460mg [Citr... 57 2e-06 >ref|XP_006472756.1| PREDICTED: WAT1-related protein At1g21890-like [Citrus sinensis] Length = 387 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/53 (56%), Positives = 36/53 (67%) Frame = +3 Query: 3 IGAVIIITGLYTVVWGKSNDRHESEASLTDVKGKALELPITQTTRSIMLDQPN 161 +GA++I+ GLYTVVWGKS D S AS TD K A ELPI T +SI +D N Sbjct: 316 LGAILIVFGLYTVVWGKSKDPPSSAASFTDEKAAAQELPI--TCKSINVDDNN 366 >ref|XP_006434165.1| hypothetical protein CICLE_v10001460mg [Citrus clementina] gi|557536287|gb|ESR47405.1| hypothetical protein CICLE_v10001460mg [Citrus clementina] Length = 387 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/53 (56%), Positives = 36/53 (67%) Frame = +3 Query: 3 IGAVIIITGLYTVVWGKSNDRHESEASLTDVKGKALELPITQTTRSIMLDQPN 161 +GA++I+ GLYTVVWGKS D S AS TD K A ELPI T +SI +D N Sbjct: 316 LGAILIVFGLYTVVWGKSKDPPSSAASFTDEKAAAQELPI--TCKSINVDDNN 366