BLASTX nr result
ID: Rheum21_contig00026728
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00026728 (239 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS59630.1| hypothetical protein M569_15175, partial [Genlise... 57 3e-06 >gb|EPS59630.1| hypothetical protein M569_15175, partial [Genlisea aurea] Length = 216 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/66 (40%), Positives = 40/66 (60%) Frame = +2 Query: 41 EDEKAENKFSVVLKANLHCNRCKTRLLKDACREHGVNSILIEDENYIKVNGNMDPIRLVS 220 E +K E +VVLKA+LHC C +++++ HGV ++ I D I V G +DP+ L Sbjct: 3 EKKKKEGSITVVLKADLHCEGCASKVVRCIRSFHGVETVAIGDGERITVLGEVDPVELQE 62 Query: 221 RLRKRT 238 RL K+T Sbjct: 63 RLEKKT 68