BLASTX nr result
ID: Rheum21_contig00026649
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00026649 (255 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_064005.1| orf152 gene product (mitochondrion) [Beta vulga... 87 6e-21 ref|YP_007516863.1| hypothetical protein GlmaxMp14 (mitochondrio... 103 3e-20 ref|XP_002538339.1| conserved hypothetical protein [Ricinus comm... 78 1e-12 >ref|NP_064005.1| orf152 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435150|ref|YP_004222368.1| hypothetical protein BevumaM_p135 [Beta vulgaris subsp. maritima] gi|346683241|ref|YP_004842173.1| hypothetical protein BemaM_p129 [Beta macrocarpa] gi|9049307|dbj|BAA99317.1| orf152 [Beta vulgaris subsp. vulgaris] gi|54606701|dbj|BAD66724.1| orf152 [Beta vulgaris subsp. vulgaris] gi|54606745|dbj|BAD66768.1| orf152 [Beta vulgaris subsp. vulgaris] gi|317905600|emb|CBJ14007.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439883|emb|CBJ17583.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148037|emb|CBJ20701.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500159|emb|CBX24978.1| hypothetical protein [Beta macrocarpa] gi|384977915|emb|CBL54139.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 152 Score = 86.7 bits (213), Expect(2) = 6e-21 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = -3 Query: 181 FYQLIPIHSVKVSTAFSRPSTERCTMLIGIGKDPLVHVLEGSIHGNH 41 ++ +PIHSVKVSTAFSRPSTERCTMLIGIGKD L+HVLEGSIHGNH Sbjct: 105 YHDSMPIHSVKVSTAFSRPSTERCTMLIGIGKDLLLHVLEGSIHGNH 151 Score = 39.7 bits (91), Expect(2) = 6e-21 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 255 ARVRIQSAHSERKKRSSW 202 ARVRIQSAHSERKKRSSW Sbjct: 79 ARVRIQSAHSERKKRSSW 96 >ref|YP_007516863.1| hypothetical protein GlmaxMp14 (mitochondrion) [Glycine max] gi|403311592|gb|AFR34340.1| hypothetical protein GlmaxMp14 (mitochondrion) [Glycine max] Length = 202 Score = 103 bits (256), Expect = 3e-20 Identities = 56/84 (66%), Positives = 62/84 (73%) Frame = -3 Query: 253 ASTHPVST*RTKKAFILDRRLNPNFYQLIPIHSVKVSTAFSRPSTERCTMLIGIGKDPLV 74 +S H S + + ++IL LN N Y+LIPIHSVKVST PSTERCTMLIGIGKD LV Sbjct: 121 SSQHAHSERKKRSSWILF--LNQNVYKLIPIHSVKVSTG---PSTERCTMLIGIGKDLLV 175 Query: 73 HVLEGSIHGNHQYFLSRTWYGFVL 2 HVLEGSIHGN FL R WYGFVL Sbjct: 176 HVLEGSIHGNQNVFLPRAWYGFVL 199 >ref|XP_002538339.1| conserved hypothetical protein [Ricinus communis] gi|223512664|gb|EEF24045.1| conserved hypothetical protein [Ricinus communis] Length = 153 Score = 78.2 bits (191), Expect = 1e-12 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = +2 Query: 2 KNKAIPCPRKKVLMIAMNAALEDVYKRVFADSYQHGAPLSRRA 130 KNKAIP PR KV+MIAMNAALEDVYK+VFADSYQHGAPLSR A Sbjct: 111 KNKAIPYPRDKVVMIAMNAALEDVYKKVFADSYQHGAPLSRGA 153