BLASTX nr result
ID: Rheum21_contig00026289
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00026289 (240 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB81696.1| hypothetical protein L484_001429 [Morus notabilis] 57 3e-06 >gb|EXB81696.1| hypothetical protein L484_001429 [Morus notabilis] Length = 167 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/77 (37%), Positives = 43/77 (55%), Gaps = 1/77 (1%) Frame = +3 Query: 3 ASEWWEGTR-LADHPGLNWEMFKAKMTDRFFSRAMRDEKHKEFMYPKTEGLKVTELATKF 179 A WW+ R + D G+ WE F+A ++FF ++ RDEK EFM + + V E +F Sbjct: 20 AGAWWKHIRRMQDVEGMTWEQFEALFNEQFFPQSYRDEKAMEFMGLQQGEMTVREYEARF 79 Query: 180 NHLLQYAGSDVTSEEQK 230 N L ++A S + SE K Sbjct: 80 NELSRFAPSLIESERMK 96