BLASTX nr result
ID: Rheum21_contig00025568
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00025568 (417 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285110.1| PREDICTED: U-box domain-containing protein 2... 65 7e-09 emb|CAN74163.1| hypothetical protein VITISV_026443 [Vitis vinifera] 65 7e-09 ref|XP_006487052.1| PREDICTED: U-box domain-containing protein 2... 64 2e-08 ref|XP_006422990.1| hypothetical protein CICLE_v10028522mg [Citr... 64 2e-08 ref|XP_002313124.2| U-box domain-containing family protein [Popu... 64 2e-08 gb|EOX98282.1| Plant U-box 26 [Theobroma cacao] 64 2e-08 ref|XP_002330475.1| predicted protein [Populus trichocarpa] gi|2... 64 2e-08 gb|ABK93469.1| unknown [Populus trichocarpa] 64 2e-08 ref|XP_004309747.1| PREDICTED: U-box domain-containing protein 2... 63 4e-08 ref|XP_006847114.1| hypothetical protein AMTR_s00017p00223570 [A... 62 6e-08 ref|XP_006346399.1| PREDICTED: U-box domain-containing protein 2... 62 8e-08 gb|EMJ01147.1| hypothetical protein PRUPE_ppa006352mg [Prunus pe... 61 1e-07 ref|XP_004230770.1| PREDICTED: U-box domain-containing protein 2... 61 2e-07 ref|XP_006406505.1| hypothetical protein EUTSA_v10022190mg [Eutr... 60 2e-07 emb|CBI32390.3| unnamed protein product [Vitis vinifera] 60 3e-07 gb|ABV89622.1| U-box domain-containing protein [Brassica rapa] 60 3e-07 ref|XP_004505237.1| PREDICTED: U-box domain-containing protein 2... 60 4e-07 gb|EXC17320.1| U-box domain-containing protein 26 [Morus notabilis] 59 5e-07 ref|XP_006583889.1| PREDICTED: U-box domain-containing protein 2... 59 7e-07 ref|XP_003529402.1| PREDICTED: U-box domain-containing protein 2... 59 7e-07 >ref|XP_002285110.1| PREDICTED: U-box domain-containing protein 26 [Vitis vinifera] Length = 415 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/52 (59%), Positives = 40/52 (76%) Frame = +2 Query: 35 GAVMRILMVVQSGATARGKRKAVALLKLLQDSWPVDSVDNSGNYICNDVVPY 190 G V ++L++VQS T R KRKA LLKLL+DSWP DSV NS ++ C+DVVP+ Sbjct: 364 GVVTQLLLLVQSDCTERAKRKAQLLLKLLRDSWPEDSVVNSDDFGCSDVVPF 415 >emb|CAN74163.1| hypothetical protein VITISV_026443 [Vitis vinifera] Length = 476 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/52 (59%), Positives = 40/52 (76%) Frame = +2 Query: 35 GAVMRILMVVQSGATARGKRKAVALLKLLQDSWPVDSVDNSGNYICNDVVPY 190 G V ++L++VQS T R KRKA LLKLL+DSWP DSV NS ++ C+DVVP+ Sbjct: 425 GVVTQLLLLVQSDCTERAKRKAQLLLKLLRDSWPEDSVVNSDDFGCSDVVPF 476 >ref|XP_006487052.1| PREDICTED: U-box domain-containing protein 26-like [Citrus sinensis] Length = 418 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/52 (53%), Positives = 40/52 (76%) Frame = +2 Query: 35 GAVMRILMVVQSGATARGKRKAVALLKLLQDSWPVDSVDNSGNYICNDVVPY 190 G + ++L++VQS T R KRKA LLKLL+DSWP DS+ NS ++ C++VVP+ Sbjct: 367 GVLTQLLLLVQSDCTDRAKRKAQLLLKLLRDSWPQDSIGNSDDFACSEVVPF 418 >ref|XP_006422990.1| hypothetical protein CICLE_v10028522mg [Citrus clementina] gi|557524924|gb|ESR36230.1| hypothetical protein CICLE_v10028522mg [Citrus clementina] Length = 418 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/52 (53%), Positives = 40/52 (76%) Frame = +2 Query: 35 GAVMRILMVVQSGATARGKRKAVALLKLLQDSWPVDSVDNSGNYICNDVVPY 190 G + ++L++VQS T R KRKA LLKLL+DSWP DS+ NS ++ C++VVP+ Sbjct: 367 GVLTQLLLLVQSDCTDRAKRKAQLLLKLLRDSWPQDSIGNSDDFACSEVVPF 418 >ref|XP_002313124.2| U-box domain-containing family protein [Populus trichocarpa] gi|550331446|gb|EEE87079.2| U-box domain-containing family protein [Populus trichocarpa] Length = 413 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/52 (53%), Positives = 41/52 (78%) Frame = +2 Query: 35 GAVMRILMVVQSGATARGKRKAVALLKLLQDSWPVDSVDNSGNYICNDVVPY 190 G + ++L++VQS T R KRKA LLKLL+D+WP DSV NS +++C++VVP+ Sbjct: 362 GILTQLLLLVQSDCTDRAKRKAQMLLKLLRDAWPEDSVGNSDDFLCSEVVPF 413 >gb|EOX98282.1| Plant U-box 26 [Theobroma cacao] Length = 416 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/52 (53%), Positives = 40/52 (76%) Frame = +2 Query: 35 GAVMRILMVVQSGATARGKRKAVALLKLLQDSWPVDSVDNSGNYICNDVVPY 190 G + ++L++VQS T R KRKA LLKLL+DSWP DS+ NS ++ C++VVP+ Sbjct: 365 GILTQLLLLVQSDCTDRAKRKAQTLLKLLRDSWPEDSIGNSDDFACSEVVPF 416 >ref|XP_002330475.1| predicted protein [Populus trichocarpa] gi|224123380|ref|XP_002330301.1| predicted protein [Populus trichocarpa] gi|566166543|ref|XP_002306161.2| hypothetical protein POPTR_0004s14720g [Populus trichocarpa] gi|550341018|gb|EEE86672.2| hypothetical protein POPTR_0004s14720g [Populus trichocarpa] Length = 413 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/52 (53%), Positives = 40/52 (76%) Frame = +2 Query: 35 GAVMRILMVVQSGATARGKRKAVALLKLLQDSWPVDSVDNSGNYICNDVVPY 190 G + ++L++VQS T R KRKA LLKLL+DSWP DS NS +++C++VVP+ Sbjct: 362 GILTQLLLLVQSDCTDRAKRKAQMLLKLLRDSWPEDSAGNSDDFVCSEVVPF 413 >gb|ABK93469.1| unknown [Populus trichocarpa] Length = 413 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/52 (53%), Positives = 41/52 (78%) Frame = +2 Query: 35 GAVMRILMVVQSGATARGKRKAVALLKLLQDSWPVDSVDNSGNYICNDVVPY 190 G + ++L++VQS T R KRKA LLKLL+D+WP DSV NS +++C++VVP+ Sbjct: 362 GILTQLLLLVQSDCTDRAKRKAQMLLKLLRDAWPEDSVGNSDDFLCSEVVPF 413 >ref|XP_004309747.1| PREDICTED: U-box domain-containing protein 26-like [Fragaria vesca subsp. vesca] Length = 415 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/50 (58%), Positives = 39/50 (78%) Frame = +2 Query: 35 GAVMRILMVVQSGATARGKRKAVALLKLLQDSWPVDSVDNSGNYICNDVV 184 G + ++L++VQS T R KRKA LLKLL+DSWP DSV NS +++C+DVV Sbjct: 365 GIMTQLLLLVQSDCTDRAKRKAQLLLKLLRDSWPEDSVGNSDDFVCSDVV 414 >ref|XP_006847114.1| hypothetical protein AMTR_s00017p00223570 [Amborella trichopoda] gi|548850143|gb|ERN08695.1| hypothetical protein AMTR_s00017p00223570 [Amborella trichopoda] Length = 420 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/52 (57%), Positives = 41/52 (78%) Frame = +2 Query: 35 GAVMRILMVVQSGATARGKRKAVALLKLLQDSWPVDSVDNSGNYICNDVVPY 190 G V ++L++VQS TAR KRKA LLKLL+D+WP +SV NS +Y C+D+VP+ Sbjct: 370 GVVTQLLLLVQSECTARAKRKAQLLLKLLRDAWPDESVANS-DYACSDIVPF 420 >ref|XP_006346399.1| PREDICTED: U-box domain-containing protein 26-like [Solanum tuberosum] Length = 415 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/52 (51%), Positives = 39/52 (75%) Frame = +2 Query: 35 GAVMRILMVVQSGATARGKRKAVALLKLLQDSWPVDSVDNSGNYICNDVVPY 190 G ++++L++VQS T R KRKA LLK L+D WP DS+ NS ++ C+DVVP+ Sbjct: 364 GVLIQLLLLVQSDCTERAKRKAQMLLKQLRDCWPEDSIANSDDFACSDVVPF 415 >gb|EMJ01147.1| hypothetical protein PRUPE_ppa006352mg [Prunus persica] Length = 416 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/53 (54%), Positives = 41/53 (77%), Gaps = 1/53 (1%) Frame = +2 Query: 35 GAVMRILMVVQSGATARGKRKAVALLKLLQDSWPVDSVDNSGNYICND-VVPY 190 G + ++L++VQS T R KRKA LLKLL+DSWP DSV NS +++C++ VVP+ Sbjct: 364 GVLTQLLLLVQSDCTDRAKRKAQLLLKLLRDSWPEDSVGNSDDFVCSELVVPF 416 >ref|XP_004230770.1| PREDICTED: U-box domain-containing protein 25-like [Solanum lycopersicum] Length = 415 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/52 (50%), Positives = 39/52 (75%) Frame = +2 Query: 35 GAVMRILMVVQSGATARGKRKAVALLKLLQDSWPVDSVDNSGNYICNDVVPY 190 G ++++L++VQS T R KRKA LLK L+D WP DS+ N+ ++ C+DVVP+ Sbjct: 364 GVLIQLLLLVQSDCTERAKRKAQMLLKQLRDCWPEDSIANTDDFACSDVVPF 415 >ref|XP_006406505.1| hypothetical protein EUTSA_v10022190mg [Eutrema salsugineum] gi|557107651|gb|ESQ47958.1| hypothetical protein EUTSA_v10022190mg [Eutrema salsugineum] Length = 420 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/52 (51%), Positives = 39/52 (75%) Frame = +2 Query: 35 GAVMRILMVVQSGATARGKRKAVALLKLLQDSWPVDSVDNSGNYICNDVVPY 190 G V+++L++VQS T R K+KA LLKLL+DSWP S NS +++C+ VVP+ Sbjct: 369 GVVVQLLLIVQSECTERAKKKAQKLLKLLRDSWPDYSFANSDDFVCSQVVPF 420 >emb|CBI32390.3| unnamed protein product [Vitis vinifera] Length = 405 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = +2 Query: 35 GAVMRILMVVQSGATARGKRKAVALLKLLQDSWPVDSVDNSGNYICNDV 181 G V ++L++VQS T R KRKA LLKLL+DSWP DSV NS ++ C+DV Sbjct: 327 GVVTQLLLLVQSDCTERAKRKAQLLLKLLRDSWPEDSVVNSDDFGCSDV 375 >gb|ABV89622.1| U-box domain-containing protein [Brassica rapa] Length = 417 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/52 (53%), Positives = 39/52 (75%) Frame = +2 Query: 35 GAVMRILMVVQSGATARGKRKAVALLKLLQDSWPVDSVDNSGNYICNDVVPY 190 G V+++L++VQS T R KRKA LLKLL+DSWP S NS ++ C++VVP+ Sbjct: 366 GVVVQLLLMVQSECTERAKRKAQKLLKLLRDSWPDYSFANSDDFACSEVVPF 417 >ref|XP_004505237.1| PREDICTED: U-box domain-containing protein 26-like [Cicer arietinum] Length = 415 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/50 (54%), Positives = 37/50 (74%) Frame = +2 Query: 35 GAVMRILMVVQSGATARGKRKAVALLKLLQDSWPVDSVDNSGNYICNDVV 184 G + ++L++VQS T R KRKA LLKLL+DSWP DS+ NS ++ C+ VV Sbjct: 362 GVLTQLLLLVQSDCTERAKRKAQLLLKLLRDSWPQDSIGNSDDFACSQVV 411 >gb|EXC17320.1| U-box domain-containing protein 26 [Morus notabilis] Length = 416 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/50 (54%), Positives = 38/50 (76%) Frame = +2 Query: 35 GAVMRILMVVQSGATARGKRKAVALLKLLQDSWPVDSVDNSGNYICNDVV 184 G + ++L++VQS T R KRKA LLKLL+DSWP DS+ NS ++ C++VV Sbjct: 364 GILTQLLLLVQSDCTDRAKRKAQLLLKLLRDSWPEDSIRNSDDFACSEVV 413 >ref|XP_006583889.1| PREDICTED: U-box domain-containing protein 26-like isoform X2 [Glycine max] Length = 444 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/50 (54%), Positives = 37/50 (74%) Frame = +2 Query: 35 GAVMRILMVVQSGATARGKRKAVALLKLLQDSWPVDSVDNSGNYICNDVV 184 G + ++L+++QS T R KRKA LLKLL+DSWP DSV NS ++ C+ VV Sbjct: 361 GVLTQLLLLMQSDCTERAKRKAQMLLKLLRDSWPQDSVGNSDDFACSQVV 410 >ref|XP_003529402.1| PREDICTED: U-box domain-containing protein 26-like isoform X1 [Glycine max] Length = 414 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/50 (54%), Positives = 37/50 (74%) Frame = +2 Query: 35 GAVMRILMVVQSGATARGKRKAVALLKLLQDSWPVDSVDNSGNYICNDVV 184 G + ++L+++QS T R KRKA LLKLL+DSWP DSV NS ++ C+ VV Sbjct: 361 GVLTQLLLLMQSDCTERAKRKAQMLLKLLRDSWPQDSVGNSDDFACSQVV 410