BLASTX nr result
ID: Rheum21_contig00024641
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00024641 (532 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB61979.1| hypothetical protein L484_002759 [Morus notabilis] 61 2e-07 ref|XP_006293268.1| hypothetical protein CARUB_v10019604mg [Caps... 60 4e-07 ref|NP_191725.1| uncharacterized protein [Arabidopsis thaliana] ... 59 9e-07 gb|EOY24961.1| Uncharacterized protein TCM_016412 [Theobroma cacao] 58 1e-06 ref|XP_002876628.1| hypothetical protein ARALYDRAFT_486654 [Arab... 58 2e-06 ref|XP_002509931.1| hypothetical protein RCOM_1691130 [Ricinus c... 57 3e-06 ref|XP_006402460.1| hypothetical protein EUTSA_v10006386mg [Eutr... 56 4e-06 ref|XP_002533908.1| conserved hypothetical protein [Ricinus comm... 56 4e-06 ref|XP_002444893.1| hypothetical protein SORBIDRAFT_07g001000 [S... 56 6e-06 gb|ESW07222.1| hypothetical protein PHAVU_010G111500g [Phaseolus... 55 8e-06 tpg|DAA61068.1| TPA: hypothetical protein ZEAMMB73_878502 [Zea m... 55 8e-06 ref|XP_002299489.1| hypothetical protein POPTR_0001s10380g [Popu... 55 8e-06 ref|XP_002303632.1| hypothetical protein POPTR_0003s13740g [Popu... 55 8e-06 >gb|EXB61979.1| hypothetical protein L484_002759 [Morus notabilis] Length = 135 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -3 Query: 488 EEGDLIMWDCGSPLYDSYELASLSHLMERHTLVLP 384 +E +L +WDCGSPLYDSYEL SLSHL+ERH ++LP Sbjct: 17 KELELAIWDCGSPLYDSYELVSLSHLIERHLMILP 51 >ref|XP_006293268.1| hypothetical protein CARUB_v10019604mg [Capsella rubella] gi|482561975|gb|EOA26166.1| hypothetical protein CARUB_v10019604mg [Capsella rubella] Length = 133 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -3 Query: 488 EEGDLIMWDCGSPLYDSYELASLSHLMERHTLVLP 384 E+ D I+WDCGSPLYDSYEL SL+H++ERH + LP Sbjct: 4 EDDDRILWDCGSPLYDSYELVSLTHIIERHFMSLP 38 >ref|NP_191725.1| uncharacterized protein [Arabidopsis thaliana] gi|6850857|emb|CAB71096.1| hypothetical protein [Arabidopsis thaliana] gi|332646716|gb|AEE80237.1| uncharacterized protein AT3G61660 [Arabidopsis thaliana] Length = 129 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = -3 Query: 488 EEGDLIMWDCGSPLYDSYELASLSHLMERHTLVLP 384 ++ D I+WDCGSPLYDSYEL SL+H++ERH + LP Sbjct: 3 DDDDRILWDCGSPLYDSYELVSLTHIIERHFMSLP 37 >gb|EOY24961.1| Uncharacterized protein TCM_016412 [Theobroma cacao] Length = 222 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -3 Query: 488 EEGDLIMWDCGSPLYDSYELASLSHLMERHTLVLPH 381 +E D I WDCGSPLYDSYELAS H++ERHT+ LP+ Sbjct: 136 KESDSI-WDCGSPLYDSYELASFGHVLERHTMALPY 170 >ref|XP_002876628.1| hypothetical protein ARALYDRAFT_486654 [Arabidopsis lyrata subsp. lyrata] gi|297322466|gb|EFH52887.1| hypothetical protein ARALYDRAFT_486654 [Arabidopsis lyrata subsp. lyrata] Length = 122 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = -3 Query: 485 EGDLIMWDCGSPLYDSYELASLSHLMERHTLVLP 384 + D I+WDCGSPLYDSYEL SL+H++ERH + LP Sbjct: 4 DDDRILWDCGSPLYDSYELVSLTHIIERHFMSLP 37 >ref|XP_002509931.1| hypothetical protein RCOM_1691130 [Ricinus communis] gi|223549830|gb|EEF51318.1| hypothetical protein RCOM_1691130 [Ricinus communis] Length = 127 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = -3 Query: 473 IMWDCGSPLYDSYELASLSHLMERHTLVLPHS 378 I+WDCGSPLYDSYE+AS+ H++ERH + LP S Sbjct: 14 IVWDCGSPLYDSYEIASVGHVIERHMMALPSS 45 >ref|XP_006402460.1| hypothetical protein EUTSA_v10006386mg [Eutrema salsugineum] gi|557103559|gb|ESQ43913.1| hypothetical protein EUTSA_v10006386mg [Eutrema salsugineum] Length = 127 Score = 56.2 bits (134), Expect = 4e-06 Identities = 21/31 (67%), Positives = 28/31 (90%) Frame = -3 Query: 476 LIMWDCGSPLYDSYELASLSHLMERHTLVLP 384 +++WDCGSPLYDSYEL SL+H++ERH + LP Sbjct: 9 IVLWDCGSPLYDSYELVSLTHIIERHFMSLP 39 >ref|XP_002533908.1| conserved hypothetical protein [Ricinus communis] gi|223526129|gb|EEF28473.1| conserved hypothetical protein [Ricinus communis] Length = 136 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = -3 Query: 488 EEGDLIMWDCGSPLYDSYELASLSHLMERHTLVLP 384 ++ DL +WD GSPLYDSYE+ SLSHL+ERH + LP Sbjct: 16 DDKDLAVWDLGSPLYDSYEVVSLSHLIERHLMTLP 50 >ref|XP_002444893.1| hypothetical protein SORBIDRAFT_07g001000 [Sorghum bicolor] gi|241941243|gb|EES14388.1| hypothetical protein SORBIDRAFT_07g001000 [Sorghum bicolor] Length = 147 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = -3 Query: 479 DLIMWDCGSPLYDSYELASLSHLMERHTLVLP 384 +L WDCGSPLYDS+ELASL +++E+HT+VLP Sbjct: 32 ELATWDCGSPLYDSFELASLHYVLEKHTMVLP 63 >gb|ESW07222.1| hypothetical protein PHAVU_010G111500g [Phaseolus vulgaris] Length = 193 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/37 (59%), Positives = 29/37 (78%) Frame = -3 Query: 488 EEGDLIMWDCGSPLYDSYELASLSHLMERHTLVLPHS 378 EE + +WDCGSPLYDS+EL SL H+++RH +V P S Sbjct: 71 EEKAMAIWDCGSPLYDSHELVSLDHIIDRHLMVFPSS 107 >tpg|DAA61068.1| TPA: hypothetical protein ZEAMMB73_878502 [Zea mays] Length = 133 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/35 (62%), Positives = 30/35 (85%) Frame = -3 Query: 488 EEGDLIMWDCGSPLYDSYELASLSHLMERHTLVLP 384 EE L WDCGSPLYDS+E+ASL +++E+HT++LP Sbjct: 27 EEPVLATWDCGSPLYDSFEVASLHYVLEKHTMILP 61 >ref|XP_002299489.1| hypothetical protein POPTR_0001s10380g [Populus trichocarpa] gi|222846747|gb|EEE84294.1| hypothetical protein POPTR_0001s10380g [Populus trichocarpa] Length = 117 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = -3 Query: 488 EEGDLIMWDCGSPLYDSYELASLSHLMERHTLVL 387 E+ + +WDCGSPLYDSYE+ASL HL++RH+L L Sbjct: 8 EQAAINVWDCGSPLYDSYEIASLGHLIDRHSLAL 41 >ref|XP_002303632.1| hypothetical protein POPTR_0003s13740g [Populus trichocarpa] gi|222841064|gb|EEE78611.1| hypothetical protein POPTR_0003s13740g [Populus trichocarpa] Length = 124 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/29 (72%), Positives = 27/29 (93%) Frame = -3 Query: 470 MWDCGSPLYDSYELASLSHLMERHTLVLP 384 +WDCGSPLYDSYE+ASL H+++RH+L LP Sbjct: 14 VWDCGSPLYDSYEIASLGHVIDRHSLALP 42