BLASTX nr result
ID: Rheum21_contig00024592
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00024592 (269 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006580908.1| PREDICTED: oxysterol-binding protein isoform... 57 3e-06 ref|XP_006827910.1| hypothetical protein AMTR_s00008p00153070 [A... 57 3e-06 ref|NP_001236590.1| oxysterol-binding protein [Glycine max] gi|1... 57 3e-06 gb|EXB44332.1| Oxysterol-binding protein-related protein 1C [Mor... 55 7e-06 ref|XP_006593585.1| PREDICTED: oxysterol-binding protein-related... 55 7e-06 ref|XP_006593584.1| PREDICTED: oxysterol-binding protein-related... 55 7e-06 >ref|XP_006580908.1| PREDICTED: oxysterol-binding protein isoform X1 [Glycine max] Length = 788 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = -1 Query: 263 SYHYRGGYWEAREQGNWGSCPKIFGDIPAV 174 SY Y GGYWEAR++GNW SCP IFG IP+V Sbjct: 749 SYRYLGGYWEARQRGNWDSCPDIFGQIPSV 778 >ref|XP_006827910.1| hypothetical protein AMTR_s00008p00153070 [Amborella trichopoda] gi|548832545|gb|ERM95326.1| hypothetical protein AMTR_s00008p00153070 [Amborella trichopoda] Length = 779 Score = 57.0 bits (136), Expect = 3e-06 Identities = 20/36 (55%), Positives = 30/36 (83%) Frame = -1 Query: 269 RKSYHYRGGYWEAREQGNWGSCPKIFGDIPAVRSIN 162 + +YHY GGYWEARE+G+WG+CP IFG P+ ++++ Sbjct: 744 KDAYHYVGGYWEARERGDWGNCPDIFGHFPSDQTLD 779 >ref|NP_001236590.1| oxysterol-binding protein [Glycine max] gi|164457637|dbj|BAF96543.1| oxysterol-binding protein [Glycine max] Length = 789 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = -1 Query: 263 SYHYRGGYWEAREQGNWGSCPKIFGDIPAV 174 SY Y GGYWEAR++GNW SCP IFG IP+V Sbjct: 750 SYRYLGGYWEARQRGNWDSCPDIFGQIPSV 779 >gb|EXB44332.1| Oxysterol-binding protein-related protein 1C [Morus notabilis] Length = 839 Score = 55.5 bits (132), Expect = 7e-06 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = -1 Query: 263 SYHYRGGYWEAREQGNWGSCPKIFGDIPA 177 +Y Y GGYWEAREQGNW SCP IFG P+ Sbjct: 806 TYRYLGGYWEAREQGNWDSCPDIFGQFPS 834 >ref|XP_006593585.1| PREDICTED: oxysterol-binding protein-related protein 1C-like isoform X2 [Glycine max] Length = 789 Score = 55.5 bits (132), Expect = 7e-06 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = -1 Query: 263 SYHYRGGYWEAREQGNWGSCPKIFGDIPA 177 +Y Y GGYWEAR+QGNW SCP IFG IP+ Sbjct: 750 TYRYLGGYWEARKQGNWNSCPDIFGHIPS 778 >ref|XP_006593584.1| PREDICTED: oxysterol-binding protein-related protein 1C-like isoform X1 [Glycine max] Length = 790 Score = 55.5 bits (132), Expect = 7e-06 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = -1 Query: 263 SYHYRGGYWEAREQGNWGSCPKIFGDIPA 177 +Y Y GGYWEAR+QGNW SCP IFG IP+ Sbjct: 751 TYRYLGGYWEARKQGNWNSCPDIFGHIPS 779