BLASTX nr result
ID: Rheum21_contig00022943
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00022943 (390 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC36144.1| Protein SRG1 [Morus notabilis] 74 2e-11 gb|EOY13558.1| Senescence-related gene 1 [Theobroma cacao] 74 3e-11 ref|XP_006416751.1| hypothetical protein EUTSA_v10008010mg [Eutr... 73 4e-11 ref|XP_003638414.1| SRG1-like protein [Medicago truncatula] gi|3... 73 4e-11 ref|XP_002300451.1| SENESCENCE-RELATED GENE 1 family protein [Po... 73 4e-11 ref|XP_002336631.1| predicted protein [Populus trichocarpa] 73 4e-11 gb|EOY13555.1| Senescence-related gene 1 [Theobroma cacao] 72 8e-11 ref|XP_002890198.1| hypothetical protein ARALYDRAFT_889094 [Arab... 72 8e-11 ref|XP_004294174.1| PREDICTED: protein SRG1-like [Fragaria vesca... 72 1e-10 ref|XP_002528475.1| Leucoanthocyanidin dioxygenase, putative [Ri... 72 1e-10 ref|XP_002300453.1| SENESCENCE-RELATED GENE 1 family protein [Po... 72 1e-10 ref|NP_173145.1| Fe(II)/ascorbate oxidase family protein SRG1 [A... 72 1e-10 ref|XP_003638405.1| Protein SRG1 [Medicago truncatula] gi|355504... 71 1e-10 gb|EOY13549.1| Senescence-related gene 1 [Theobroma cacao] 71 2e-10 ref|XP_004488976.1| PREDICTED: protein SRG1-like [Cicer arietinum] 71 2e-10 ref|XP_006305429.1| hypothetical protein CARUB_v10009827mg [Caps... 71 2e-10 ref|XP_006355630.1| PREDICTED: protein SRG1-like [Solanum tubero... 70 3e-10 ref|XP_006442326.1| hypothetical protein CICLE_v10023825mg [Citr... 70 3e-10 ref|XP_002869680.1| oxidoreductase [Arabidopsis lyrata subsp. ly... 70 3e-10 gb|EXB58295.1| Protein SRG1 [Morus notabilis] 70 4e-10 >gb|EXC36144.1| Protein SRG1 [Morus notabilis] Length = 293 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/53 (62%), Positives = 42/53 (79%) Frame = -3 Query: 388 GLTLVLQLNEVVGLQFKKDGKWIPIKPLPHAFIVNVGDAMEVSNLKLHVLPFF 230 GLT++LQ++EV GLQ KKDG W+P+KPLP+AFIVN+GD +EV N L FF Sbjct: 230 GLTILLQISEVEGLQIKKDGMWVPVKPLPNAFIVNIGDIVEVINYHLFFFFFF 282 >gb|EOY13558.1| Senescence-related gene 1 [Theobroma cacao] Length = 639 Score = 73.6 bits (179), Expect = 3e-11 Identities = 30/42 (71%), Positives = 39/42 (92%) Frame = -3 Query: 388 GLTLVLQLNEVVGLQFKKDGKWIPIKPLPHAFIVNVGDAMEV 263 GLT++LQ+NEV GLQ KKDGKW+P+KPLP+AFIVN+GD +E+ Sbjct: 206 GLTILLQVNEVEGLQVKKDGKWVPVKPLPNAFIVNIGDVLEI 247 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/41 (73%), Positives = 39/41 (95%) Frame = -3 Query: 385 LTLVLQLNEVVGLQFKKDGKWIPIKPLPHAFIVNVGDAMEV 263 LT++LQ+NEV GLQ KKDGKW+P+KPLP++FIVN+GDA+EV Sbjct: 520 LTILLQVNEVEGLQVKKDGKWVPVKPLPNSFIVNIGDALEV 560 >ref|XP_006416751.1| hypothetical protein EUTSA_v10008010mg [Eutrema salsugineum] gi|557094522|gb|ESQ35104.1| hypothetical protein EUTSA_v10008010mg [Eutrema salsugineum] Length = 360 Score = 72.8 bits (177), Expect = 4e-11 Identities = 29/42 (69%), Positives = 39/42 (92%) Frame = -3 Query: 388 GLTLVLQLNEVVGLQFKKDGKWIPIKPLPHAFIVNVGDAMEV 263 GLT++LQ+N+V GLQ KKDGKW+P+KPLP+AFIVN+GD +E+ Sbjct: 240 GLTILLQVNDVEGLQIKKDGKWVPVKPLPNAFIVNIGDVLEI 281 >ref|XP_003638414.1| SRG1-like protein [Medicago truncatula] gi|355504349|gb|AES85552.1| SRG1-like protein [Medicago truncatula] Length = 400 Score = 72.8 bits (177), Expect = 4e-11 Identities = 31/55 (56%), Positives = 42/55 (76%) Frame = -3 Query: 385 LTLVLQLNEVVGLQFKKDGKWIPIKPLPHAFIVNVGDAMEVSNLKLHVLPFFTPY 221 LT++LQLN+V GLQ +KDG W+P+KPLP+AFIVN+GD +EV N+ + F Y Sbjct: 257 LTILLQLNDVEGLQVRKDGMWVPVKPLPNAFIVNIGDMLEVKNIYSFIKHFVVSY 311 >ref|XP_002300451.1| SENESCENCE-RELATED GENE 1 family protein [Populus trichocarpa] gi|222847709|gb|EEE85256.1| SENESCENCE-RELATED GENE 1 family protein [Populus trichocarpa] Length = 359 Score = 72.8 bits (177), Expect = 4e-11 Identities = 30/42 (71%), Positives = 39/42 (92%) Frame = -3 Query: 388 GLTLVLQLNEVVGLQFKKDGKWIPIKPLPHAFIVNVGDAMEV 263 GLT++LQ+NEV GLQ +KDGKW+PIKPLP+AF+VNVGD +E+ Sbjct: 234 GLTILLQVNEVEGLQLRKDGKWVPIKPLPNAFVVNVGDILEI 275 >ref|XP_002336631.1| predicted protein [Populus trichocarpa] Length = 151 Score = 72.8 bits (177), Expect = 4e-11 Identities = 30/42 (71%), Positives = 39/42 (92%) Frame = -3 Query: 388 GLTLVLQLNEVVGLQFKKDGKWIPIKPLPHAFIVNVGDAMEV 263 GLT++LQ+NEV GLQ +KDGKW+PIKPLP+AF+VNVGD +E+ Sbjct: 26 GLTILLQVNEVEGLQLRKDGKWVPIKPLPNAFVVNVGDILEI 67 >gb|EOY13555.1| Senescence-related gene 1 [Theobroma cacao] Length = 375 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/42 (71%), Positives = 39/42 (92%) Frame = -3 Query: 388 GLTLVLQLNEVVGLQFKKDGKWIPIKPLPHAFIVNVGDAMEV 263 GLT++ Q+NEV GLQ KKDGKW+P+KPLP+AFIVN+GDA+E+ Sbjct: 255 GLTILHQVNEVEGLQVKKDGKWLPVKPLPNAFIVNIGDALEI 296 >ref|XP_002890198.1| hypothetical protein ARALYDRAFT_889094 [Arabidopsis lyrata subsp. lyrata] gi|297336040|gb|EFH66457.1| hypothetical protein ARALYDRAFT_889094 [Arabidopsis lyrata subsp. lyrata] Length = 358 Score = 72.0 bits (175), Expect = 8e-11 Identities = 28/42 (66%), Positives = 39/42 (92%) Frame = -3 Query: 388 GLTLVLQLNEVVGLQFKKDGKWIPIKPLPHAFIVNVGDAMEV 263 GLT+++Q+NEV GLQ KKDGKW+P+KP+P+AFIVN+GD +E+ Sbjct: 238 GLTVLMQVNEVEGLQIKKDGKWVPVKPIPNAFIVNIGDVLEI 279 >ref|XP_004294174.1| PREDICTED: protein SRG1-like [Fragaria vesca subsp. vesca] Length = 375 Score = 71.6 bits (174), Expect = 1e-10 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = -3 Query: 388 GLTLVLQLNEVVGLQFKKDGKWIPIKPLPHAFIVNVGDAMEV 263 GLT++LQ+NE+ GLQ KKDG W+P+KPLP AFIVN+GDA+E+ Sbjct: 255 GLTILLQVNELEGLQIKKDGNWLPVKPLPEAFIVNIGDALEI 296 >ref|XP_002528475.1| Leucoanthocyanidin dioxygenase, putative [Ricinus communis] gi|223532084|gb|EEF33892.1| Leucoanthocyanidin dioxygenase, putative [Ricinus communis] Length = 364 Score = 71.6 bits (174), Expect = 1e-10 Identities = 27/42 (64%), Positives = 39/42 (92%) Frame = -3 Query: 388 GLTLVLQLNEVVGLQFKKDGKWIPIKPLPHAFIVNVGDAMEV 263 GLT++LQ+N+V GLQ KKDGKW+P+KPLP+AF++N+GD +E+ Sbjct: 239 GLTILLQVNDVEGLQIKKDGKWVPVKPLPNAFVINIGDILEI 280 >ref|XP_002300453.1| SENESCENCE-RELATED GENE 1 family protein [Populus trichocarpa] gi|222847711|gb|EEE85258.1| SENESCENCE-RELATED GENE 1 family protein [Populus trichocarpa] Length = 355 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = -3 Query: 388 GLTLVLQLNEVVGLQFKKDGKWIPIKPLPHAFIVNVGDAMEV 263 GLT++LQ+NEV GLQ KKDGKW+P+KPLP+AFI NVGD +E+ Sbjct: 235 GLTILLQVNEVEGLQVKKDGKWVPVKPLPNAFIFNVGDILEI 276 >ref|NP_173145.1| Fe(II)/ascorbate oxidase family protein SRG1 [Arabidopsis thaliana] gi|75220747|sp|Q39224.1|SRG1_ARATH RecName: Full=Protein SRG1; Short=AtSRG1; AltName: Full=Protein SENESCENCE-RELATED GENE 1 gi|5734767|gb|AAD50032.1|AC007651_27 SRG1 Protein [Arabidopsis thaliana] gi|479047|emb|CAA55654.1| SRG1 [Arabidopsis thaliana] gi|15081819|gb|AAK82564.1| F6I1.30/F6I1.30 [Arabidopsis thaliana] gi|22655018|gb|AAM98100.1| At1g17020/F6I1.30 [Arabidopsis thaliana] gi|332191410|gb|AEE29531.1| Fe(II)/ascorbate oxidase family protein SRG1 [Arabidopsis thaliana] Length = 358 Score = 71.6 bits (174), Expect = 1e-10 Identities = 28/42 (66%), Positives = 39/42 (92%) Frame = -3 Query: 388 GLTLVLQLNEVVGLQFKKDGKWIPIKPLPHAFIVNVGDAMEV 263 GLT+++Q+N+V GLQ KKDGKW+P+KPLP+AFIVN+GD +E+ Sbjct: 238 GLTVLMQVNDVEGLQIKKDGKWVPVKPLPNAFIVNIGDVLEI 279 >ref|XP_003638405.1| Protein SRG1 [Medicago truncatula] gi|355504340|gb|AES85543.1| Protein SRG1 [Medicago truncatula] Length = 359 Score = 71.2 bits (173), Expect = 1e-10 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = -3 Query: 388 GLTLVLQLNEVVGLQFKKDGKWIPIKPLPHAFIVNVGDAMEV 263 G+TL+LQLNEV GLQ +KDG W+P+KPLP+AFIVN+GD +E+ Sbjct: 235 GVTLLLQLNEVEGLQIRKDGMWVPVKPLPNAFIVNIGDVLEI 276 >gb|EOY13549.1| Senescence-related gene 1 [Theobroma cacao] Length = 351 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = -3 Query: 388 GLTLVLQLNEVVGLQFKKDGKWIPIKPLPHAFIVNVGDAMEV 263 GLT++LQLN+V GLQ KKDGKW P+KPLP AFIVNVGD +E+ Sbjct: 231 GLTILLQLNQVEGLQIKKDGKWTPVKPLPDAFIVNVGDILEM 272 >ref|XP_004488976.1| PREDICTED: protein SRG1-like [Cicer arietinum] Length = 355 Score = 70.9 bits (172), Expect = 2e-10 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = -3 Query: 388 GLTLVLQLNEVVGLQFKKDGKWIPIKPLPHAFIVNVGDAMEV 263 GLT++LQLNEV GLQ +KDG W+P+KPLP+AFIVN+GD +E+ Sbjct: 235 GLTILLQLNEVEGLQVRKDGMWVPVKPLPNAFIVNIGDILEI 276 >ref|XP_006305429.1| hypothetical protein CARUB_v10009827mg [Capsella rubella] gi|482574140|gb|EOA38327.1| hypothetical protein CARUB_v10009827mg [Capsella rubella] Length = 309 Score = 70.9 bits (172), Expect = 2e-10 Identities = 28/42 (66%), Positives = 38/42 (90%) Frame = -3 Query: 388 GLTLVLQLNEVVGLQFKKDGKWIPIKPLPHAFIVNVGDAMEV 263 GLT+++Q+NEV GLQ KKDGKW+P+KP P+AFIVN+GD +E+ Sbjct: 189 GLTVLMQINEVEGLQIKKDGKWVPVKPQPNAFIVNIGDVLEI 230 >ref|XP_006355630.1| PREDICTED: protein SRG1-like [Solanum tuberosum] Length = 355 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = -3 Query: 388 GLTLVLQLNEVVGLQFKKDGKWIPIKPLPHAFIVNVGDAMEV 263 GLT++LQ+NE+ GLQ KKDG WIPI PLP+AF+VNVGDA+E+ Sbjct: 234 GLTILLQVNEIEGLQIKKDGIWIPILPLPNAFVVNVGDALEI 275 >ref|XP_006442326.1| hypothetical protein CICLE_v10023825mg [Citrus clementina] gi|557544588|gb|ESR55566.1| hypothetical protein CICLE_v10023825mg [Citrus clementina] Length = 253 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = -3 Query: 388 GLTLVLQLNEVVGLQFKKDGKWIPIKPLPHAFIVNVGDAMEV 263 GLT++LQ+NEV GLQ KKDG WIP+ PLP+AF+VNVGD ME+ Sbjct: 128 GLTILLQINEVEGLQIKKDGMWIPLTPLPNAFLVNVGDIMEI 169 >ref|XP_002869680.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] gi|297315516|gb|EFH45939.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] Length = 356 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = -3 Query: 388 GLTLVLQLNEVVGLQFKKDGKWIPIKPLPHAFIVNVGDAMEV 263 GLT++LQ+NEV GLQ KKDGKW+ +KPLP+AF+VNVGD +E+ Sbjct: 236 GLTILLQVNEVDGLQIKKDGKWVSVKPLPNAFVVNVGDILEI 277 >gb|EXB58295.1| Protein SRG1 [Morus notabilis] Length = 367 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -3 Query: 388 GLTLVLQLNEVVGLQFKKDGKWIPIKPLPHAFIVNVGDAMEV 263 GLT++LQ+NE GLQ +KDG WIP+KPLP+AFIVNVGD +E+ Sbjct: 240 GLTILLQINETEGLQIRKDGMWIPVKPLPNAFIVNVGDILEI 281