BLASTX nr result
ID: Rheum21_contig00022559
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00022559 (473 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003627749.1| hypothetical protein MTR_8g037800 [Medicago ... 56 4e-06 >ref|XP_003627749.1| hypothetical protein MTR_8g037800 [Medicago truncatula] gi|355521771|gb|AET02225.1| hypothetical protein MTR_8g037800 [Medicago truncatula] gi|388492214|gb|AFK34173.1| unknown [Medicago truncatula] Length = 91 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/47 (53%), Positives = 32/47 (68%) Frame = -1 Query: 347 EISHEMGFEEAREVLVRERMLRMNSHDYGRYNPSPTLSKPRFKRIPN 207 E++ +M E + ER+LR N+ DYGRY+PSPT SKP FK IPN Sbjct: 45 EVTTKMAMNEEEVRSIHERLLRANTKDYGRYDPSPTFSKPPFKLIPN 91