BLASTX nr result
ID: Rheum21_contig00022197
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00022197 (852 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511106.1| conserved hypothetical protein [Ricinus comm... 57 8e-06 >ref|XP_002511106.1| conserved hypothetical protein [Ricinus communis] gi|223550221|gb|EEF51708.1| conserved hypothetical protein [Ricinus communis] Length = 555 Score = 57.0 bits (136), Expect = 8e-06 Identities = 43/114 (37%), Positives = 62/114 (54%), Gaps = 2/114 (1%) Frame = -2 Query: 338 ASVTDDEDGHGYGGGFRFASPAVSPPPSHRLSKDVRDHSYLLHNQYSYLPAVS-DRRNRA 162 + DD+D GFRF++P PPP+ S +HS +N P++S R NR+ Sbjct: 64 SQTADDDDDEDDDLGFRFSAP---PPPAPS-SFSNNNHSGNNNNNSITAPSISLARPNRS 119 Query: 161 PTPLTGRNFVDNHAVSVRSTPPTR-ALTNTTAYLRAPTKNSIKNYNVTPSIELP 3 P+P GRNF + H SVRS+ R +++ T L PTK+SI+ P+IE P Sbjct: 120 PSPALGRNFAE-HVPSVRSSSAGRPSISVRTGTLVPPTKSSIRTPISIPAIEPP 172