BLASTX nr result
ID: Rheum21_contig00022018
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00022018 (218 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAM64838.1| hypothetical protein [Beta vulgaris] 59 5e-07 >dbj|BAM64838.1| hypothetical protein [Beta vulgaris] Length = 1148 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/59 (45%), Positives = 44/59 (74%), Gaps = 1/59 (1%) Frame = -3 Query: 177 DKLKLHTLKNLQTLWGGS-VGGSWMLKELPRLSPSVRKLQLQGITSQKQLEAVFQCPSI 4 ++L+L LKNLQ LWG GG+W +E+P+LS ++RKL++ ++++K LE+ F CPS+ Sbjct: 694 EELQLSALKNLQVLWGVQCTGGNWFSREIPKLSTTLRKLRVV-VSTEKDLESAFSCPSL 751