BLASTX nr result
ID: Rheum21_contig00022002
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00022002 (201 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263206.2| PREDICTED: phosphoribosylaminoimidazole carb... 57 2e-06 emb|CBI35194.3| unnamed protein product [Vitis vinifera] 57 2e-06 emb|CAN83526.1| hypothetical protein VITISV_024806 [Vitis vinifera] 57 2e-06 >ref|XP_002263206.2| PREDICTED: phosphoribosylaminoimidazole carboxylase, chloroplastic-like [Vitis vinifera] Length = 634 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +1 Query: 1 PSLQARMGQYLEDQKNEVLDKANRLEKEGWEAYLNP 108 P LQARM QY ED K++VL KA +LEK+GWE+YLNP Sbjct: 599 PDLQARMSQYQEDTKDDVLVKAEKLEKDGWESYLNP 634 >emb|CBI35194.3| unnamed protein product [Vitis vinifera] Length = 591 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +1 Query: 1 PSLQARMGQYLEDQKNEVLDKANRLEKEGWEAYLNP 108 P LQARM QY ED K++VL KA +LEK+GWE+YLNP Sbjct: 556 PDLQARMSQYQEDTKDDVLVKAEKLEKDGWESYLNP 591 >emb|CAN83526.1| hypothetical protein VITISV_024806 [Vitis vinifera] Length = 604 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +1 Query: 1 PSLQARMGQYLEDQKNEVLDKANRLEKEGWEAYLNP 108 P LQARM QY ED K++VL KA +LEK+GWE+YLNP Sbjct: 569 PDLQARMSQYQEDTKDDVLVKAEKLEKDGWESYLNP 604