BLASTX nr result
ID: Rheum21_contig00021118
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00021118 (203 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS61858.1| hypothetical protein M569_12936 [Genlisea aurea] 55 7e-06 >gb|EPS61858.1| hypothetical protein M569_12936 [Genlisea aurea] Length = 211 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/52 (44%), Positives = 36/52 (69%) Frame = -3 Query: 189 KLFINFWIEGYGMIESEKLEEAARDVETLYGAELLVQAINVEWAFRNGSYSR 34 ++F+N ++GY +IE E EA + +++L G+ELL Q INV+WAF G + R Sbjct: 140 EIFMNMTLQGYALIEYENFAEAKKAIDSLNGSELLTQIINVDWAFSKGPFRR 191