BLASTX nr result
ID: Rheum21_contig00020570
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00020570 (225 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002317252.2| hypothetical protein POPTR_0011s04040g [Popu... 64 2e-08 ref|XP_006437478.1| hypothetical protein CICLE_v10030735mg [Citr... 60 2e-07 gb|EMJ04548.1| hypothetical protein PRUPE_ppa020375mg [Prunus pe... 60 4e-07 gb|EMT16299.1| Disease resistance RPP13-like protein 4 [Aegilops... 59 9e-07 gb|EMS47410.1| Disease resistance RPP13-like protein 4 [Triticum... 59 9e-07 ref|XP_004306210.1| PREDICTED: disease resistance RPP13-like pro... 58 2e-06 gb|EXC02091.1| hypothetical protein L484_024056 [Morus notabilis] 57 2e-06 ref|XP_002526857.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 gb|EMT23572.1| hypothetical protein F775_04187 [Aegilops tauschii] 57 3e-06 gb|EMJ04915.1| hypothetical protein PRUPE_ppa019132mg [Prunus pe... 57 3e-06 ref|XP_006646671.1| PREDICTED: uncharacterized protein LOC102705... 57 3e-06 gb|EMJ13792.1| hypothetical protein PRUPE_ppa016037mg [Prunus pe... 57 3e-06 gb|EMJ17482.1| hypothetical protein PRUPE_ppa020458mg [Prunus pe... 55 8e-06 ref|XP_004985800.1| PREDICTED: disease resistance RPP13-like pro... 55 1e-05 ref|XP_004985799.1| PREDICTED: disease resistance RPP13-like pro... 55 1e-05 >ref|XP_002317252.2| hypothetical protein POPTR_0011s04040g [Populus trichocarpa] gi|550327546|gb|EEE97864.2| hypothetical protein POPTR_0011s04040g [Populus trichocarpa] Length = 818 Score = 64.3 bits (155), Expect = 2e-08 Identities = 35/75 (46%), Positives = 43/75 (57%), Gaps = 9/75 (12%) Frame = +2 Query: 20 YESLTKMEKNCLLCFSVFPLDEKTGSSKRLVIKKRILIHWWLSEGFI---------EEAG 172 Y SL +K CLLCFSVFP + V+KKR+L++WW+ EGFI EE Sbjct: 330 YSSLDLRDKLCLLCFSVFP--------ENSVVKKRLLMYWWVGEGFIDPKVDADKPEEVA 381 Query: 173 KQILKVLEEKGFIEP 217 ILK EKGF+EP Sbjct: 382 DGILKKFLEKGFVEP 396 >ref|XP_006437478.1| hypothetical protein CICLE_v10030735mg [Citrus clementina] gi|557539674|gb|ESR50718.1| hypothetical protein CICLE_v10030735mg [Citrus clementina] Length = 800 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/70 (42%), Positives = 44/70 (62%), Gaps = 10/70 (14%) Frame = +2 Query: 41 EKNCLLCFSVFPLDEKTGSSKRLVIKKRILIHWWLSEGFI----------EEAGKQILKV 190 +++CLLCF+VFP + VIKKR+L++WW+ EGF+ E+A ++L+ Sbjct: 242 DQSCLLCFAVFP--------ENAVIKKRLLVNWWIGEGFLKERIQGENSAEKAADKLLRE 293 Query: 191 LEEKGFIEPV 220 EEKGFI PV Sbjct: 294 FEEKGFILPV 303 >gb|EMJ04548.1| hypothetical protein PRUPE_ppa020375mg [Prunus persica] Length = 700 Score = 59.7 bits (143), Expect = 4e-07 Identities = 32/77 (41%), Positives = 42/77 (54%), Gaps = 10/77 (12%) Frame = +2 Query: 20 YESLTKMEKNCLLCFSVFPLDEKTGSSKRLVIKKRILIHWWLSEGF----------IEEA 169 Y SL+ + K CLLCF+ P +E IKKR+L+HWW+ EGF +EE Sbjct: 167 YNSLSVITKLCLLCFAAIPANE--------AIKKRVLVHWWVGEGFVNPPVDGEKTVEEI 218 Query: 170 GKQILKVLEEKGFIEPV 220 I + L +KG IEPV Sbjct: 219 ADGIFQELTKKGCIEPV 235 >gb|EMT16299.1| Disease resistance RPP13-like protein 4 [Aegilops tauschii] Length = 888 Score = 58.5 bits (140), Expect = 9e-07 Identities = 32/72 (44%), Positives = 42/72 (58%), Gaps = 3/72 (4%) Frame = +2 Query: 14 NSYESLTKMEKNCLLCFSVFPLDEKTGSSKRLVIKKRILIHWWLSEGFIEEA--GKQIL- 184 +S L + CLLC +VFP D VIKKR+LIHWW+ EGF+ GK + Sbjct: 425 DSINGLETRLRQCLLCLAVFPEDA--------VIKKRLLIHWWIGEGFVSSVSEGKNVFN 476 Query: 185 KVLEEKGFIEPV 220 ++L KGFI+PV Sbjct: 477 ELLITKGFIKPV 488 >gb|EMS47410.1| Disease resistance RPP13-like protein 4 [Triticum urartu] Length = 886 Score = 58.5 bits (140), Expect = 9e-07 Identities = 32/72 (44%), Positives = 42/72 (58%), Gaps = 3/72 (4%) Frame = +2 Query: 14 NSYESLTKMEKNCLLCFSVFPLDEKTGSSKRLVIKKRILIHWWLSEGFIEEA--GKQIL- 184 +S L + CLLC +VFP D VIKKR+LIHWW+ EGF+ GK + Sbjct: 423 DSINGLETRLRQCLLCLAVFPEDA--------VIKKRLLIHWWIGEGFVSSVSEGKNVFN 474 Query: 185 KVLEEKGFIEPV 220 ++L KGFI+PV Sbjct: 475 ELLITKGFIKPV 486 >ref|XP_004306210.1| PREDICTED: disease resistance RPP13-like protein 4-like [Fragaria vesca subsp. vesca] Length = 679 Score = 57.8 bits (138), Expect = 2e-06 Identities = 34/74 (45%), Positives = 42/74 (56%), Gaps = 5/74 (6%) Frame = +2 Query: 14 NSYESL-TKMEKNCLLCFSVFPLDEKTGSSKRLVIKKRILIHWWLSEGF----IEEAGKQ 178 N Y SL T K CLLCF+VFP +E V+KK+ L+HWW+ EG +EE Sbjct: 182 NVYNSLGTVTTKLCLLCFAVFPANE--------VLKKKRLVHWWVGEGILYPPVEEIADG 233 Query: 179 ILKVLEEKGFIEPV 220 I + L KG IEPV Sbjct: 234 IFEELTTKGCIEPV 247 >gb|EXC02091.1| hypothetical protein L484_024056 [Morus notabilis] Length = 848 Score = 57.4 bits (137), Expect = 2e-06 Identities = 33/78 (42%), Positives = 42/78 (53%), Gaps = 11/78 (14%) Frame = +2 Query: 20 YESLTKMEKNCLLCFSVFPLDEKTGSSKRLVIKKRILIHWWLSEGF-----------IEE 166 YE L K CLLCFS+F +E+ +KKR+L +WW EGF IE+ Sbjct: 292 YEGLEDKAKKCLLCFSLFTENEE--------LKKRMLTYWWEGEGFLRADDGDGKKAIED 343 Query: 167 AGKQILKVLEEKGFIEPV 220 A +IL+ E KG IEPV Sbjct: 344 AAGEILERFEAKGLIEPV 361 >ref|XP_002526857.1| conserved hypothetical protein [Ricinus communis] gi|223533756|gb|EEF35488.1| conserved hypothetical protein [Ricinus communis] Length = 720 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/76 (36%), Positives = 46/76 (60%), Gaps = 7/76 (9%) Frame = +2 Query: 17 SYESLTKMEKNCLLCFSVFPLDEKTGSSKRLVIKKRILIHWWLSEGFI-------EEAGK 175 ++E LT ++CLLCFSVFP + V+ KR+L++WW+ EGFI ++ Sbjct: 208 TFERLTPSYQHCLLCFSVFP--------EGAVVSKRMLMYWWVGEGFIFPAVNNYDDTAD 259 Query: 176 QILKVLEEKGFIEPVM 223 +IL + +K +I+PV+ Sbjct: 260 EILSIFFKKDYIQPVI 275 >gb|EMT23572.1| hypothetical protein F775_04187 [Aegilops tauschii] Length = 593 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/61 (47%), Positives = 36/61 (59%), Gaps = 2/61 (3%) Frame = +2 Query: 44 KNCLLCFSVFPLDEKTGSSKRLVIKKRILIHWWLSEGFIE--EAGKQILKVLEEKGFIEP 217 + CLLC FP + TG IKKR L+HWW+ EGF+E E G K L +KGFI P Sbjct: 171 RGCLLCLVAFPGEGATG------IKKRTLVHWWIGEGFVESPEEGNIRFKELVDKGFITP 224 Query: 218 V 220 + Sbjct: 225 L 225 >gb|EMJ04915.1| hypothetical protein PRUPE_ppa019132mg [Prunus persica] Length = 636 Score = 57.0 bits (136), Expect = 3e-06 Identities = 31/77 (40%), Positives = 41/77 (53%), Gaps = 10/77 (12%) Frame = +2 Query: 20 YESLTKMEKNCLLCFSVFPLDEKTGSSKRLVIKKRILIHWWLSEGFIE----------EA 169 Y SL K CLLCF+VFP +E VIKK +L+HWW+ EGF+ E Sbjct: 133 YNSLCVTTKLCLLCFAVFPANE--------VIKKGLLVHWWIGEGFLNPPVDGKETVVEI 184 Query: 170 GKQILKVLEEKGFIEPV 220 + + L +KG IEP+ Sbjct: 185 ADGVFEELTKKGCIEPL 201 >ref|XP_006646671.1| PREDICTED: uncharacterized protein LOC102705874 [Oryza brachyantha] Length = 866 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/60 (43%), Positives = 39/60 (65%), Gaps = 2/60 (3%) Frame = +2 Query: 50 CLLCFSVFPLDEKTGSSKRLVIKKRILIHWWLSEGFIE--EAGKQILKVLEEKGFIEPVM 223 CLLC ++FP +E VIKKRILIHWW+ EG ++ +AGK+ L ++G ++P + Sbjct: 129 CLLCLAIFPPNE--------VIKKRILIHWWIGEGIVKSADAGKECFDDLFDRGLVQPAL 180 >gb|EMJ13792.1| hypothetical protein PRUPE_ppa016037mg [Prunus persica] Length = 635 Score = 56.6 bits (135), Expect = 3e-06 Identities = 31/77 (40%), Positives = 38/77 (49%), Gaps = 10/77 (12%) Frame = +2 Query: 20 YESLTKMEKNCLLCFSVFPLDEKTGSSKRLVIKKRILIHWWLSEGFI----------EEA 169 Y L K C LCFSVFP + VIKK++L+HWW+ EGFI E+ Sbjct: 157 YNGLDVTLKLCFLCFSVFP--------ENAVIKKKVLVHWWVGEGFIDTLGTSGKTAEDT 208 Query: 170 GKQILKVLEEKGFIEPV 220 Q EKG I+PV Sbjct: 209 ANQFFNDFIEKGLIKPV 225 >gb|EMJ17482.1| hypothetical protein PRUPE_ppa020458mg [Prunus persica] Length = 675 Score = 55.5 bits (132), Expect = 8e-06 Identities = 33/80 (41%), Positives = 44/80 (55%), Gaps = 9/80 (11%) Frame = +2 Query: 5 NSLNSYESLTKME-KNCLLCFSVFPLDEKTGSSKRLVIKKRILIHWWLSEGFI------- 160 N + SYE L E + C L FS+FP + VIKKR LI+WW+ EGFI Sbjct: 169 NMMRSYEHLEGTELRLCFLSFSIFPAES--------VIKKRPLIYWWIGEGFITATQDKT 220 Query: 161 -EEAGKQILKVLEEKGFIEP 217 EE G++I L ++G I+P Sbjct: 221 TEEVGEEIFGKLMKQGLIQP 240 >ref|XP_004985800.1| PREDICTED: disease resistance RPP13-like protein 4-like isoform X2 [Setaria italica] Length = 597 Score = 55.1 bits (131), Expect = 1e-05 Identities = 29/76 (38%), Positives = 41/76 (53%), Gaps = 8/76 (10%) Frame = +2 Query: 17 SYESLTKMEKNCLLCFSVFPLDEKTGSSKRLVIKKRILIHWWLSEGFI--------EEAG 172 SY++L K CLLCFS+FP + +I KR +IHWW+ EG + E+ G Sbjct: 179 SYDNLDLQLKLCLLCFSIFPDNS--------IISKRAMIHWWIGEGLVEATRSQTAEDVG 230 Query: 173 KQILKVLEEKGFIEPV 220 K+ + L + IEPV Sbjct: 231 KECFEKLIAREMIEPV 246 >ref|XP_004985799.1| PREDICTED: disease resistance RPP13-like protein 4-like isoform X1 [Setaria italica] Length = 627 Score = 55.1 bits (131), Expect = 1e-05 Identities = 29/76 (38%), Positives = 41/76 (53%), Gaps = 8/76 (10%) Frame = +2 Query: 17 SYESLTKMEKNCLLCFSVFPLDEKTGSSKRLVIKKRILIHWWLSEGFI--------EEAG 172 SY++L K CLLCFS+FP + +I KR +IHWW+ EG + E+ G Sbjct: 162 SYDNLDLQLKLCLLCFSIFPDNS--------IISKRAMIHWWIGEGLVEATRSQTAEDVG 213 Query: 173 KQILKVLEEKGFIEPV 220 K+ + L + IEPV Sbjct: 214 KECFEKLIAREMIEPV 229